Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: STRA8Antibody Dilution: 1.0ug/mlSample Type: Human Lung)

Rabbit STRA8 Polyclonal Antibody | anti-STRA8 antibody

STRA8 antibody - C-terminal region

Reactivity
Dog, Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
STRA8; Polyclonal Antibody; STRA8 antibody - C-terminal region; anti-STRA8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PEEKFQLYMQIINFFKGLSCANTQVKQEASFPVDEEMIMLQCTETFDDED
Sequence Length
330
Applicable Applications for anti-STRA8 antibody
Western Blot (WB)
Homology
Dog: 77%; Human: 100%; Pig: 77%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: STRA8Antibody Dilution: 1.0ug/mlSample Type: Human Lung)

Western Blot (WB) (Host: RabbitTarget Name: STRA8Antibody Dilution: 1.0ug/mlSample Type: Human Lung)
Related Product Information for anti-STRA8 antibody
This is a rabbit polyclonal antibody against STRA8. It was validated on Western Blot

Target Description: This gene encodes a retinoic acid-responsive protein. A homologous protein in mouse has been shown to be involved in the regulation of meiotic initiation in both spermatogenesis and oogenesis, though feature differences between the mouse and human proteins suggest that these homologs are not entirely functionally equivalent. It is thought that this gene may play a role in spermatogenesis in humans.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
stimulated by retinoic acid gene 8 protein homolog
NCBI Official Synonym Full Names
stimulated by retinoic acid 8
NCBI Official Symbol
STRA8
NCBI Protein Information
stimulated by retinoic acid gene 8 protein homolog
UniProt Protein Name
Stimulated by retinoic acid gene 8 protein homolog
UniProt Gene Name
STRA8
UniProt Entry Name
STRA8_HUMAN

NCBI Description

This gene encodes a retinoic acid-responsive protein. A homologous protein in mouse has been shown to be involved in the regulation of meiotic initiation in both spermatogenesis and oogenesis, though feature differences between the mouse and human proteins suggest that these homologs are not entirely functionally equivalent. It is thought that this gene may play a role in spermatogenesis in humans. [provided by RefSeq, Nov 2010]

Uniprot Description

STRA8: Meiosis-inducer required for the transition into meiosis for both female and male germ cells. In female germ cells, required for premeiotic DNA replication and subsequent events in meiotic prophase.

Chromosomal Location of Human Ortholog: 7q33

Cellular Component: cytoplasm; nucleus

Molecular Function: protein dimerization activity

Biological Process: fertilization; meiotic cell cycle DNA replication checkpoint; ovarian follicle development; meiotic chromosome condensation; meiotic recombination; synapsis; meiotic DNA double-strand break formation; spermatogenesis; regulation of organ growth; female meiosis sister chromatid cohesion; DNA replication; oocyte development

Research Articles on STRA8

Similar Products

Product Notes

The STRA8 stra8 (Catalog #AAA3216240) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STRA8 antibody - C-terminal region reacts with Dog, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's STRA8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the STRA8 stra8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PEEKFQLYMQ IINFFKGLSC ANTQVKQEAS FPVDEEMIML QCTETFDDED. It is sometimes possible for the material contained within the vial of "STRA8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.