Western Blot (WB)
(Host: RabbitTarget Name: STOML2Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human STOML2 Polyclonal Antibody | anti-STOML2 antibody
STOML2 Antibody - N-terminal region
Gene Names
STOML2; SLP-2; HSPC108
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
STOML2; Polyclonal Antibody; STOML2 Antibody - N-terminal region; anti-STOML2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLLRGSLLASGRAPRRASSGLPRNTVVLFVPQQEAWVVERMGRFHRILEP
Sequence Length
96
Applicable Applications for anti-STOML2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human STOML2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: STOML2Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: STOML2Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1.0ug/ml)
Product Categories/Family for anti-STOML2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39 kDa
NCBI Official Full Name
stomatin-like protein 2, mitochondrial isoform b
NCBI Official Synonym Full Names
stomatin like 2
NCBI Official Symbol
STOML2
NCBI Official Synonym Symbols
SLP-2; HSPC108
NCBI Protein Information
stomatin-like protein 2, mitochondrial
UniProt Protein Name
Stomatin-like protein 2, mitochondrial
Protein Family
UniProt Gene Name
STOML2
UniProt Synonym Gene Names
SLP2; SLP-2; Paratarg-7
UniProt Entry Name
STML2_HUMAN
Uniprot Description
SLP-2: Belongs to the band 7/mec-2 family.
Protein type: Cytoskeletal; Mitochondrial
Chromosomal Location of Human Ortholog: 9p13.1
Cellular Component: extrinsic to plasma membrane; signalosome; T cell receptor complex; cytoskeleton; mitochondrial inner membrane; immunological synapse; mitochondrial intermembrane space; lipid raft; actin cytoskeleton
Molecular Function: protein binding; receptor binding
Biological Process: cellular calcium ion homeostasis; mitochondrion organization and biogenesis; mitochondrial ATP synthesis coupled proton transport; interleukin-2 production; mitochondrial calcium ion transport; T cell receptor signaling pathway; protein oligomerization
Research Articles on STOML2
Similar Products
Product Notes
The STOML2 stoml2 (Catalog #AAA3220652) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STOML2 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's STOML2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the STOML2 stoml2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLLRGSLLAS GRAPRRASSG LPRNTVVLFV PQQEAWVVER MGRFHRILEP. It is sometimes possible for the material contained within the vial of "STOML2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
