Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence analysis of A549 cells using STK19 antibody. Blue: DAPI for nuclear staining.)

Rabbit STK19 Polyclonal Antibody | anti-STK19 antibody

STK19 Polyclonal Antibody

Gene Names
STK19; G11; RP1; D6S60; D6S60E; HLA-RP1
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purification
Synonyms
STK19; Polyclonal Antibody; STK19 Polyclonal Antibody; D6S60; D6S60E; G11; HLA-RP1; RP1; anti-STK19 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
GTPGETVRHCSAPEDPIFRFSSLHSYPFPGTIKSRDMSWKRHHLIPETFGVKRRRKRGPVESDPLRGEPGSARAAVSELMQLFPRGLFEDALPPIVLRSQVYSLVPDRTVADRQLKELQEQGEIRIVQLGFDLDAHGIIFTEDYRTRVLKACDGRPYAGAVQKFLASVLPACGDLSFQQDQMTQTFGFRDSEITHLVNAGVLTVRDAGSWWLAVPGAGRFIKYFVKGRQAVLSMVRKAKYRELLLSELLGRRAPV
Sequence Length
364
Applicable Applications for anti-STK19 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
WB: 1:500 - 1:2000
IF: 1:50 - 1:200
Immunogen
Recombinant protein of human STK19
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

Immunofluorescence (IF)

(Immunofluorescence analysis of A549 cells using STK19 antibody. Blue: DAPI for nuclear staining.)

Immunofluorescence (IF) (Immunofluorescence analysis of A549 cells using STK19 antibody. Blue: DAPI for nuclear staining.)
Related Product Information for anti-STK19 antibody
This gene encodes a serine/threonine kinase which localizes predominantly to the nucleus. Its specific function is unknown; it is possible that phosphorylation of this protein is involved in transcriptional regulation. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6 and expresses two transcript variants.
Product Categories/Family for anti-STK19 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa/40kDa
NCBI Official Full Name
serine/threonine-protein kinase 19 isoform 1
NCBI Official Synonym Full Names
serine/threonine kinase 19
NCBI Official Symbol
STK19
NCBI Official Synonym Symbols
G11; RP1; D6S60; D6S60E; HLA-RP1
NCBI Protein Information
serine/threonine-protein kinase 19
UniProt Protein Name
Serine/threonine-protein kinase 19
UniProt Gene Name
STK19
UniProt Synonym Gene Names
G11; RP1

NCBI Description

This gene encodes a serine/threonine kinase which localizes predominantly to the nucleus. Its specific function is unknown; it is possible that phosphorylation of this protein is involved in transcriptional regulation. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6 and expresses two transcript variants. [provided by RefSeq, Jul 2008]

Uniprot Description

Seems to be a protein kinase. In vitro it can phosphorylate casein-alpha on serine and threonine residues and histones on serine residues.

Research Articles on STK19

Similar Products

Product Notes

The STK19 stk19 (Catalog #AAA9133425) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STK19 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's STK19 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). WB: 1:500 - 1:2000 IF: 1:50 - 1:200. Researchers should empirically determine the suitability of the STK19 stk19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GTPGETVRHC SAPEDPIFRF SSLHSYPFPG TIKSRDMSWK RHHLIPETFG VKRRRKRGPV ESDPLRGEPG SARAAVSELM QLFPRGLFED ALPPIVLRSQ VYSLVPDRTV ADRQLKELQE QGEIRIVQLG FDLDAHGIIF TEDYRTRVLK ACDGRPYAGA VQKFLASVLP ACGDLSFQQD QMTQTFGFRD SEITHLVNAG VLTVRDAGSW WLAVPGAGRF IKYFVKGRQA VLSMVRKAKY RELLLSELLG RRAPV. It is sometimes possible for the material contained within the vial of "STK19, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.