Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-STEAP4 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

Rabbit STEAP4 Polyclonal Antibody | anti-STEAP4 antibody

STEAP4 antibody - C-terminal region

Gene Names
STEAP4; TIARP; STAMP2; SchLAH; TNFAIP9
Reactivity
Cow, Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
STEAP4; Polyclonal Antibody; STEAP4 antibody - C-terminal region; anti-STEAP4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AFLHVLYTLVIPIRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSDSYVA
Sequence Length
459
Applicable Applications for anti-STEAP4 antibody
Western Blot (WB)
Homology
Cow: 83%; Human: 100%; Rabbit: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human STEAP4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-STEAP4 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-STEAP4 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-STEAP4 antibody
This is a rabbit polyclonal antibody against STEAP4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Metalloreductase has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+). It uses NAD(+) as acceptor.
Product Categories/Family for anti-STEAP4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
metalloreductase STEAP4 isoform 1
NCBI Official Synonym Full Names
STEAP4 metalloreductase
NCBI Official Symbol
STEAP4
NCBI Official Synonym Symbols
TIARP; STAMP2; SchLAH; TNFAIP9
NCBI Protein Information
metalloreductase STEAP4
UniProt Protein Name
Metalloreductase STEAP4
Protein Family
UniProt Gene Name
STEAP4
UniProt Synonym Gene Names
STAMP2; TNFAIP9
UniProt Entry Name
STEA4_HUMAN

NCBI Description

The protein encoded by this gene belongs to the STEAP (six transmembrane epithelial antigen of prostate) family, and resides in the golgi apparatus. It functions as a metalloreductase that has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+), using NAD(+) as acceptor. Studies in mice and human suggest that this gene maybe involved in adipocyte development and metabolism, and may contribute to the normal biology of the prostate cell, as well as prostate cancer progression. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2011]

Uniprot Description

STEAP4: Metalloreductase that has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+). Uses NAD(+) as acceptor. Plays a role in systemic metabolic homeostasis, integrating inflammatory and metabolic responses. Associated with obesity and insulin-resistance. Involved in inflammatory arthritis, through the regulation of inflammatory cytokines. Inhibits anchorage-independent cell proliferation. Belongs to the STEAP family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Oxidoreductase; EC 1.16.1.-

Chromosomal Location of Human Ortholog: 7q21.12

Cellular Component: Golgi membrane; integral to membrane; plasma membrane; endosome

Molecular Function: metal ion binding; cupric reductase activity

Biological Process: fat cell differentiation; iron ion homeostasis; copper ion import

Research Articles on STEAP4

Similar Products

Product Notes

The STEAP4 steap4 (Catalog #AAA3209661) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STEAP4 antibody - C-terminal region reacts with Cow, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's STEAP4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the STEAP4 steap4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AFLHVLYTLV IPIRYYVRWR LGNLTVTQAI LKKENPFSTS SAWLSDSYVA. It is sometimes possible for the material contained within the vial of "STEAP4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.