Stathmin 1 Polyclonal Antibody | anti-STMN1 antibody

Anti-Stathmin 1 Antibody

Cat. Num. AAA178178

• Gene Names: STMN1; Lag; SMN; OP18; PP17; PP19; PR22; LAP18; C1orf215
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: Stathmin 1; Polyclonal Antibody; Anti-Stathmin 1 Antibody; Stathmin; C1orf215; Lag; LAP 18; LAP18; Leukemia associated phosphoprotein p18; Leukemia-associated phosphoprotein p18; Metablastin; Oncoprotein 18; OP 18; OP18; p18; p19; Phosphoprotein 19; Phosphoprotein p19; PP17; PP19; PR22; Pr22 protein; Prosolin; Protein Pr22; SMN; Stathmin1; STMN 1; STMN1; STMN1_HUMAN; stathmin 1; anti-STMN1 antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 174

• Applicable Applications for anti-STMN1 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Stathmin 1 (2-34aa ASSDIQVKELEKRASGQAFELILSPRSKESVPE), different from the related mouse sequence by one amino acid, and identical to the related rat sequence.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- Stathmin 1 Picoband antibody, MBS178178, Western blottingAll lanes: Anti Stathmin 1 (MBS178178) at 0.5ug/mlLane 1: Mouse Brain Tissue Lysate at 50ugLane 2: Mouse Testis Tissue Lysate at 50ugLane 3: MM231 Whole Cell Lysate at 40ugLane 4: MCF-7 Whole Cell Lysate at 40ugPredicted bind size: 17KDObserved bind size: 17KD )

Immunohistochemistry (IHC)

(nti- Stathmin 1 Picoband antibody, MBS178178, IHC(P)IHC(P): Mouse Testis Tissue )

Immunohistochemistry (IHC)

(nti- Stathmin 1 Picoband antibody, MBS178178, IHC(P)IHC(P): Rat Brain Tissue )

Immunohistochemistry (IHC)

(nti- Stathmin 1 Picoband antibody, MBS178178, IHC(P)IHC(P): Human Mammary Cancer Tissue )

Related Product Information for anti-STMN1 antibody

Description: Rabbit IgG polyclonal antibody for Stathmin(STMN1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Stathmin 1/oncoprotein 18, also known as STMN1, is a highly conserved 17 kDa protein. This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene.

References

1. Cassimeris L (February 2002). "The oncoprotein 18/stathmin family of microtubule destabilizers". Curr. Opin. Cell Biol. 14 (1): 18-24. 2. Clément MJ, Jourdain I, Lachkar S, Savarin P, Gigant B, Knossow M, Toma F, Sobel A, Curmi PA (November 2005). "N-terminal stathmin-like peptides bind tubulin and impede microtubule assembly". Biochemistry 44 (44): 14616-25. 3. Jourdain L, Curmi P, Sobel A, Pantaloni D, Carlier MF (September 1997). "Stathmin: a tubulin-sequestering protein which forms a ternary T2S complex with two tubulin molecules". Biochemistry 36 (36): 10817-21.

NCBI and Uniprot Product Information

• NCBI GI #: 224451142
• NCBI GeneID: 3925
• NCBI Accession #: NP_001138926.1
• NCBI GenBank Nucleotide #: NM_001145454.2
• UniProt Accession #: P16949; A2A2D1; B2R4E7; B7Z8N4; D3DPJ5
• Molecular Weight: 19,824 Da
• NCBI Official Full Name: stathmin isoform b
• NCBI Official Synonym Full Names: stathmin 1
• NCBI Official Symbol: STMN1
• NCBI Official Synonym Symbols: Lag; SMN; OP18; PP17; PP19; PR22; LAP18; C1orf215
• NCBI Protein Information: stathmin
• UniProt Protein Name: Stathmin
• Protein Family: Stathmin
• UniProt Gene Name: STMN1
• UniProt Synonym Gene Names: C1orf215; LAP18; OP18; Op18; pp19
• UniProt Entry Name: STMN1_HUMAN

NCBI Description

This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2009]

Uniprot Description

STMN1: a microtubule-associated protein involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Phosphorylation reduces tubulin binding 10-fold and suppresses the MT polymerization inhibition activity. Present in much greater abundance in cells from patients with acute leukemia of different subtypes than in normal peripheral blood lymphocytes, nonleukemic proliferating lymphoid cells, bone marrow cells, or cells from patients with chronic lymphoid or myeloid leukemia.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: 1p36.11

Cellular Component: cytoplasm; cytosol; intracellular; membrane; microtubule; neuron projection

Molecular Function: protein binding; signal transducer activity; tubulin binding

Biological Process: axonogenesis; brain development; cytokinesis after mitosis; microtubule depolymerization; mitotic spindle organization and biogenesis; negative regulation of microtubule polymerization; neurite development; positive regulation of cell motility; regulation of cytoskeleton organization and biogenesis; response to virus; signal transduction