Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Uterus)

Rabbit STAT3 Polyclonal Antibody | anti-STAT3 antibody

STAT3 antibody - middle region

Gene Names
STAT3; APRF; HIES; ADMIO; ADMIO1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
STAT3; Polyclonal Antibody; STAT3 antibody - middle region; anti-STAT3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLD
Sequence Length
770
Applicable Applications for anti-STAT3 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human STAT3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Uterus)

Immunohistochemistry (IHC) (Human Uterus)

Immunohistochemistry (IHC)

(Immunohistochemistry with Thymus tissue at an antibody concentration of 5.0ug/ml using anti-STAT3 antibody )

Immunohistochemistry (IHC) (Immunohistochemistry with Thymus tissue at an antibody concentration of 5.0ug/ml using anti-STAT3 antibody )

Western Blot (WB)

(Host: RabbitTarget Name: STAT3Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: STAT3Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-STAT3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: 721_B cell lysateSTAT3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Western Blot (WB) (WB Suggested Anti-STAT3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: 721_B cell lysateSTAT3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Related Product Information for anti-STAT3 antibody
This is a rabbit polyclonal antibody against STAT3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: STAT3 is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act a

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
88kDa
NCBI Official Full Name
signal transducer and activator of transcription 3 isoform 1
NCBI Official Synonym Full Names
signal transducer and activator of transcription 3
NCBI Official Symbol
STAT3
NCBI Official Synonym Symbols
APRF; HIES; ADMIO; ADMIO1
NCBI Protein Information
signal transducer and activator of transcription 3
UniProt Protein Name
Signal transducer and activator of transcription 3
UniProt Gene Name
STAT3
UniProt Synonym Gene Names
APRF
UniProt Entry Name
STAT3_HUMAN

NCBI Description

The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. This protein mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein. Mutations in this gene are associated with infantile-onset multisystem autoimmune disease and hyper-immunoglobulin E syndrome. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Sep 2015]

Uniprot Description

STAT3: transcription factor of the STAT family. Phosphorylated and activated by receptor-associated kinases downstream of many cytokines and growth-factor receptors. Constitutively active in a number of human tumors. Forms homo- or heterodimers that translocate into the nucleus where they regulate transcription. Two alternatively spliced isoforms have been described.

Protein type: Transcription factor; Nuclear receptor co-regulator; Motility/polarity/chemotaxis; DNA-binding

Chromosomal Location of Human Ortholog: 17q21.31

Cellular Component: nucleoplasm; cytoplasm; mitochondrial inner membrane; plasma membrane; cytosol; nucleus

Molecular Function: protein dimerization activity; protein binding; ligand-dependent nuclear receptor activity; signal transducer activity; DNA binding; sequence-specific DNA binding; protein kinase binding; transcription factor binding; protein phosphatase binding; transcription factor activity; CCR5 chemokine receptor binding; glucocorticoid receptor binding

Biological Process: transcription from RNA polymerase II promoter; nerve growth factor receptor signaling pathway; viral reproduction; somatic stem cell maintenance; positive regulation of transcription, DNA-dependent; radial glial cell differentiation; thermoregulation; negative regulation of transcription from RNA polymerase II promoter; glucose homeostasis; signal transduction; response to estradiol stimulus; negative regulation of cell proliferation; astrocyte differentiation; regulation of transcription, DNA-dependent; protein import into nucleus; acute-phase response; negative regulation of glycolysis; positive regulation of Notch signaling pathway; response to drug; nervous system development; intracellular receptor-mediated signaling pathway; eating behavior; cytokine and chemokine mediated signaling pathway; regulation of multicellular organism growth; JAK-STAT cascade; cellular response to hormone stimulus; regulation of transcription from RNA polymerase II promoter; cell proliferation; response to ethanol; sexual reproduction; positive regulation of transcription from RNA polymerase II promoter; eye photoreceptor cell differentiation; cell motility; phosphorylation

Disease: Hyper-ige Recurrent Infection Syndrome, Autosomal Dominant; Autoimmune Disease, Multisystem, Infantile-onset

Research Articles on STAT3

Similar Products

Product Notes

The STAT3 stat3 (Catalog #AAA3224461) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STAT3 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's STAT3 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the STAT3 stat3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FGKYCRPESQ EHPEADPGSA APYLKTKFIC VTPTTCSNTI DLPMSPRTLD. It is sometimes possible for the material contained within the vial of "STAT3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.