STAT1 Polyclonal Antibody | anti-STAT1 antibody

Anti-STAT1 Antibody

Cat. Num. AAA178387

• Gene Names: STAT1; CANDF7; IMD31A; IMD31B; IMD31C; ISGF-3; STAT91
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: STAT1; Polyclonal Antibody; Anti-STAT1 Antibody; Signal transducer and activator of transcription 1-alpha/beta; Signal transducer and activator of transcription 1 91kD; DKFZp686B04100; ISGF 3; ISGF-3; OTTHUMP00000163552; OTTHUMP00000165046; OTTHUMP00000165047; OTTHUMP00000205845; Signal transducer and activator of transcription 1 91kDa; Signal transducer and activator of transcription 1 alpha/ beta; Signal transducer and activator of transcription 1; 91kD; Signal Transductor and Activator of Transcription 1; STAT 1; STAT 91; Stat1; STAT1_HUMAN; STAT91; Transcription factor ISGF 3 components p91 p84; Transcription factor ISGF-3 components p91/p84; signal transducer and activator of transcription 1; 91kDa; anti-STAT1 antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 750

• Applicable Applications for anti-STAT1 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human STAT1 (114-143aa KILENAQRFNQAQSGNIQSTVMLDKQKELD), different from the related mouse sequence by two amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- STAT1 Picoband antibody, MBS178387, Western blottingAll lanes: Anti STAT1 (MBS178387) at 0.5ug/mlLane 1: Rat Testis Tissue Lysate at 50ugLane 2: Rat Brain Tissue Lysate at 50ugLane 3: Rat Liver Tissue Lysate at 50ugLane 4: Human Placenta Tissue Lysate at 50ugLane 5: MCF-7 Whole Cell Lysate at 40ugLane 6: SW620 Whole Cell Lysate at 40ugPredicted bind size: 91KD(Alpha), 84KD(Beta)Observed bind size: 91KD(Alpha), 84KD(Beta) )

Immunohistochemistry (IHC)

(Anti- STAT1 Picoband antibody, MBS178387, IHC(P)IHC(P): Mouse Intestine Tissue )

Immunohistochemistry (IHC)

(Anti- STAT1 Picoband antibody, MBS178387, IHC(P)IHC(P): Rat Intestine Tissue )

Immunohistochemistry (IHC)

(Anti- STAT1 Picoband antibody, MBS178387, IHC(P)IHC(P): Human Mammary Cancer Tissue )

Related Product Information for anti-STAT1 antibody

Description: Rabbit IgG polyclonal antibody for Signal transducer and activator of transcription 1-alpha/beta (STAT1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: The crystal structure of the DNA complex of a 67-kD core fragment of the STAT1 homodimer was determined, lacking only the N-domain and the C-terminal transcriptional activation domain, at 2.9-angstrom resolution. Phosphorylation of Signal Transducer and Activator of transcription 1(STAT 1) was also decreased in rheumatoid arthritis lymphocytes. The transcription factor signal transducer and activator of transcription-1 (STAT1) plays a key role in immunity against mycobacterial and viral infections. Activation of the signal transducers and activators of transcription (STAT) pathway is important in fibroblast growth factor (FGF) modulation of chondrocyte proliferation and endochondral bone formation during embryogenesis.

References

1. Chapgier, A.; Boisson-Dupuis, S.; Jouanguy, E.; Vogt, G.; Feinberg, J.; Prochnicka-Chalufour, A.; Casrouge, A.; Yang, K.; Soudais, C.; Fieschi, C.; Santos, O. F.; Bustamante, J.; and 10 others : Novel STAT1 alleles in otherwise healthy patients with mycobacterial disease. PLoS Genet. 2: e131, 2006. Note: Electronic Article. 2. Ihle, J. N. : STATs: signal transducers and activators of transcription. Cell 84: 331-334, 1996. 3. Xiao, L.; Naganawa, T.; Obugunde, E.; Gronowicz, G.; Ornitz, D. M.; Coffin, J. D.; Hurley, M. M. : Stat1 controls postnatal bone formation by regulating fibroblast growth factor signaling in osteoblasts. J. Biol. Chem. 279: 27743-27752, 2004.

NCBI and Uniprot Product Information

• NCBI GI #: 6274552
• NCBI GeneID: 6772
• NCBI Accession #: NP_009330.1
• NCBI GenBank Nucleotide #: NM_007315.3
• UniProt Accession #: P42224; Q53S88; Q53XW4; Q68D00; Q9UDL5; A8K989; B2RCA0; D2KFR8; D3DPI7
• Molecular Weight: 83,043 Da
• NCBI Official Full Name: signal transducer and activator of transcription 1-alpha/beta isoform alpha
• NCBI Official Synonym Full Names: signal transducer and activator of transcription 1
• NCBI Official Symbol: STAT1
• NCBI Official Synonym Symbols: CANDF7; IMD31A; IMD31B; IMD31C; ISGF-3; STAT91
• NCBI Protein Information: signal transducer and activator of transcription 1-alpha/beta
• UniProt Protein Name: Signal transducer and activator of transcription 1-alpha/beta
• Protein Family: Signal transducer and activator of transcription
• UniProt Gene Name: STAT1
• UniProt Entry Name: STAT1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein can be activated by various ligands including interferon-alpha, interferon-gamma, EGF, PDGF and IL6. This protein mediates the expression of a variety of genes, which is thought to be important for cell viability in response to different cell stimuli and pathogens. Two alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

STAT1: transcription factor of the STAT family. Phosphorylated and activated by receptor-associated kinases downstream of certain receptor tyrosine kinases, GPCRs, and receptors for various interleukins and interferons. Forms homo- or heterodimers that translocate into the nucleus where they regulate transcription. Two alternatively spliced isoforms have been described.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 2q32.2

Cellular Component: axon; cytoplasm; cytosol; dendrite; nuclear chromatin; nucleolus; nucleoplasm; nucleus; perinuclear region of cytoplasm

Molecular Function: double-stranded DNA binding; enzyme binding; identical protein binding; protein binding; protein homodimerization activity; signal transducer activity; transcription factor activity; tumor necrosis factor receptor binding

Biological Process: apoptosis; blood circulation; defense response to virus; endothelial cell migration; JAK-STAT cascade; negative regulation of angiogenesis; negative regulation of endothelial cell proliferation; negative regulation of I-kappaB kinase/NF-kappaB cascade; negative regulation of transcription from RNA polymerase II promoter; negative regulation of viral protein levels in host cell; positive regulation of mesenchymal cell proliferation; positive regulation of smooth muscle cell proliferation; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; regulation of apoptosis; regulation of transcription from RNA polymerase II promoter; response to cAMP; response to cytokine stimulus; response to peptide hormone stimulus; transcription, DNA-dependent; tumor necrosis factor-mediated signaling pathway; viral reproduction

Disease: Immunodeficiency 31a; Immunodeficiency 31b; Immunodeficiency 31c