Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: STAP2Sample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human STAP2 Polyclonal Antibody | anti-STAP2 antibody

STAP2 Antibody - N-terminal region

Gene Names
STAP2; BKS
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
STAP2; Polyclonal Antibody; STAP2 Antibody - N-terminal region; anti-STAP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DFQHVEKLNLGAFEKLTDEIPWGSSRDPGTHFSLILRDQEIKFKVETLEC
Sequence Length
403
Applicable Applications for anti-STAP2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human STAP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: STAP2Sample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: STAP2Sample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-STAP2 antibody
This is a rabbit polyclonal antibody against STAP2. It was validated on Western Blot

Target Description: This gene encodes the substrate of breast tumor kinase, an Src-type non-receptor tyrosine kinase. The encoded protein possesses domains and several tyrosine phosphorylation sites characteristic of adaptor proteins that mediate the interactions linking proteins involved in signal transduction pathways. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-STAP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
signal-transducing adaptor protein 2 isoform 2
NCBI Official Synonym Full Names
signal transducing adaptor family member 2
NCBI Official Symbol
STAP2
NCBI Official Synonym Symbols
BKS
NCBI Protein Information
signal-transducing adaptor protein 2
UniProt Protein Name
Signal-transducing adaptor protein 2
UniProt Gene Name
STAP2
UniProt Synonym Gene Names
BKS; STAP-2; BRK substrate
UniProt Entry Name
STAP2_HUMAN

NCBI Description

This gene encodes the substrate of breast tumor kinase, an Src-type non-receptor tyrosine kinase. The encoded protein possesses domains and several tyrosine phosphorylation sites characteristic of adaptor proteins that mediate the interactions linking proteins involved in signal transduction pathways. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008]

Uniprot Description

STAP2: a widely expressed proimflammatory adaptor protein that regulates immune and inflammatory responses. Binds and modulates a variety of molecules including Brk, CSFR, FCER1, and BCR-ABL. The interaction between STAP-2 and BCR-ABL appears to provide a growth advantage to BCR-ABL+ chronic myeloid leukemia cells. Suppression of STAP-2 expression in K562 CML cells suppressed tumor formation in mice. Enables intestinal proinflammatory responses in vivo: promotes macrophage recruitment in dextran sodium sulfate induced colitis, and promotes the ability of CXCL12-induced migration in macrophages. STAP-2 knockdown in T47D breast cancer cells induced a significant decrease of proliferation. Contains a pleckstrin homology, Src homology 2-like, and as well as a STAT3-binding domains. Two isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: cytoplasm; plasma membrane

Molecular Function: protein binding

Research Articles on STAP2

Similar Products

Product Notes

The STAP2 stap2 (Catalog #AAA3219610) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STAP2 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's STAP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the STAP2 stap2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DFQHVEKLNL GAFEKLTDEI PWGSSRDPGT HFSLILRDQE IKFKVETLEC. It is sometimes possible for the material contained within the vial of "STAP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.