Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ST7Sample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human ST7 Polyclonal Antibody | anti-ST7 antibody

ST7 Antibody - middle region

Gene Names
ST7; HELG; RAY1; SEN4; TSG7; ETS7q; FAM4A; FAM4A1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ST7; Polyclonal Antibody; ST7 Antibody - middle region; anti-ST7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LRPLLGGVDNNSSNNSNSSNGDSDSNRQSVSECKVWRNPLNLFRGAEYNR
Sequence Length
399
Applicable Applications for anti-ST7 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human ST7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ST7Sample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ST7Sample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ST7 antibody
This is a rabbit polyclonal antibody against ST7. It was validated on Western Blot

Target Description: The gene for this product maps to a region on chromosome 7 identified as an autism-susceptibility locus. Mutation screening of the entire coding region in autistic individuals failed to identify phenotype-specific variants, suggesting that coding mutations for this gene are unlikely to be involved in the etiology of autism. The function of this gene product has not been determined. Transcript variants encoding different isoforms of this protein have been described.
Product Categories/Family for anti-ST7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
Suppressor of tumorigenicity 7 protein
NCBI Official Synonym Full Names
suppression of tumorigenicity 7
NCBI Official Symbol
ST7
NCBI Official Synonym Symbols
HELG; RAY1; SEN4; TSG7; ETS7q; FAM4A; FAM4A1
NCBI Protein Information
suppressor of tumorigenicity 7 protein
UniProt Protein Name
Suppressor of tumorigenicity 7 protein
UniProt Gene Name
ST7
UniProt Synonym Gene Names
FAM4A1; HELG; RAY1
UniProt Entry Name
ST7_HUMAN

NCBI Description

The gene for this product maps to a region on chromosome 7 identified as an autism-susceptibility locus. Mutation screening of the entire coding region in autistic individuals failed to identify phenotype-specific variants, suggesting that coding mutations for this gene are unlikely to be involved in the etiology of autism. The function of this gene product has not been determined. Transcript variants encoding different isoforms of this protein have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

ST7: May act as a tumor suppressor. Belongs to the ST7 family. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 7q31.2

Cellular Component: integral to membrane

Research Articles on ST7

Similar Products

Product Notes

The ST7 st7 (Catalog #AAA3219609) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ST7 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ST7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ST7 st7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LRPLLGGVDN NSSNNSNSSN GDSDSNRQSV SECKVWRNPL NLFRGAEYNR. It is sometimes possible for the material contained within the vial of "ST7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.