Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SSX5Sample Type: Thymus Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit SSX5 Polyclonal Antibody | anti-SSX5 antibody

SSX5 Antibody - C-terminal region

Reactivity
Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SSX5; Polyclonal Antibody; SSX5 Antibody - C-terminal region; anti-SSX5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ASGPQNNGKQLRPSGKLNTSEKVNKTSGPKRGKHAWTHRVRERKQLVIYE
Sequence Length
229
Applicable Applications for anti-SSX5 antibody
Western Blot (WB)
Homology
Human: 100%; Mouse: 89%; Pig: 100%; Rabbit: 89%; Rat: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human SSX5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SSX5Sample Type: Thymus Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SSX5Sample Type: Thymus Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SSX5 antibody
This is a rabbit polyclonal antibody against SSX5. It was validated on Western Blot

Target Description: The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneous humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. While some of the related SSX genes are involved in t(X;18)(p11.2;q11.2) translocations that are characteristically found in all synovial sarcomas, this gene does not appear to be involved in such translocations. Two transcript variants encoding distinct isoforms have been identified for this gene.
Product Categories/Family for anti-SSX5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
protein SSX5 isoform a
NCBI Official Synonym Full Names
SSX family member 5
NCBI Official Symbol
SSX5
NCBI Protein Information
protein SSX5
UniProt Protein Name
Protein SSX5
Protein Family
UniProt Gene Name
SSX5

NCBI Description

The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneous humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. While some of the related SSX genes are involved in t(X;18)(p11.2;q11.2) translocations that are characteristically found in all synovial sarcomas, this gene does not appear to be involved in such translocations. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2013]

Uniprot Description

Ssxb8: Could act as a modulator of transcription. Belongs to the SSX family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cancer Testis Antigen (CTA)

Chromosomal Location of Human Ortholog: Xp11.23

Cellular Component: nucleus

Molecular Function: nucleic acid binding; protein binding; transcription corepressor activity

Biological Process: regulation of transcription, DNA-templated; transcription, DNA-dependent

Research Articles on SSX5

Similar Products

Product Notes

The SSX5 ssx5 (Catalog #AAA3204204) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SSX5 Antibody - C-terminal region reacts with Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SSX5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SSX5 ssx5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ASGPQNNGKQ LRPSGKLNTS EKVNKTSGPK RGKHAWTHRV RERKQLVIYE. It is sometimes possible for the material contained within the vial of "SSX5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.