Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of SSU72 expression in transfected 293T cell line by SSU72 polyclonal antibody. Lane 1: SSU72 transfected lysate (21.34kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human SSU72 Polyclonal Antibody | anti-SSU72 antibody

SSU72 (RNA Polymerase II Subunit A C-terminal Domain Phosphatase SSU72, CTD Phosphatase SSU72, HSPC182, PNAS-120)

Reactivity
Human
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
SSU72; Polyclonal Antibody; SSU72 (RNA Polymerase II Subunit A C-terminal Domain Phosphatase SSU72; CTD Phosphatase SSU72; HSPC182; PNAS-120); Anti -SSU72 (RNA Polymerase II Subunit A C-terminal Domain Phosphatase SSU72; anti-SSU72 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SSU72.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MPSSPLRVAVVCSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVDIQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQEFEEKSGRTFLHTVCFY
Applicable Applications for anti-SSU72 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Western Blot and Immunofluorescence.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full length human SSU72, aa1-194 (NP_054907.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SSU72 expression in transfected 293T cell line by SSU72 polyclonal antibody. Lane 1: SSU72 transfected lysate (21.34kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SSU72 expression in transfected 293T cell line by SSU72 polyclonal antibody. Lane 1: SSU72 transfected lysate (21.34kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to SSU72 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of purified antibody to SSU72 on HeLa cell. [antibody concentration 10ug/ml])
Product Categories/Family for anti-SSU72 antibody

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
23,469 Da
NCBI Official Full Name
SSU72
UniProt Protein Name
RNA polymerase II subunit A C-terminal domain phosphatase SSU72
UniProt Gene Name
SSU72
UniProt Synonym Gene Names
CTD phosphatase SSU72
UniProt Entry Name
SSU72_YEAST

Uniprot Description

Function: Component of the cleavage and polyadenylation factor (CPF) complex, which plays a key role in polyadenylation-dependent pre-mRNA 3'-end formation and cooperates with cleavage factors including the CFIA complex and NAB4/CFIB. Component of the APT complex, which may be involved in polyadenylation-independent transcript 3'-end formation. SSU72 is required for 3'-end formation of snoRNAs. Ref.5 Ref.7Processively dephosphorylates Ser-5 of the heptad repeats YSPTSPS in the C-terminal domain of the largest RNA polymerase II subunit (RPB1). Ref.5 Ref.7

Catalytic activity: A phosphoprotein + H2O = a protein + phosphate.

Subunit structure: Component of the cleavage and polyadenylation factor (CPF) complex, which is composed of PTI1, SYC1, SSU72, GLC7, MPE1, REF2, PFS2, PTA1, YSH1/BRR5, SWD2, CFT2/YDH1, YTH1, CFT1/YHH1, FIP1 and PAP1. Component of the APT complex, which is a subcomplex of CPF, and is composed of PTI1, SYC1, SSU72, GLC7, REF2, PTA1 and SWD2. Ref.6

Subcellular location: Nucleus Ref.6.

Sequence similarities: Belongs to the SSU72 phosphatase family.

Similar Products

Product Notes

The SSU72 ssu72 (Catalog #AAA6008464) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SSU72 (RNA Polymerase II Subunit A C-terminal Domain Phosphatase SSU72, CTD Phosphatase SSU72, HSPC182, PNAS-120) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SSU72 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). Suitable for use in Western Blot and Immunofluorescence. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the SSU72 ssu72 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPSSPLRVAV VCSSNQNRSM EAHNILSKRG FSVRSFGTGT HVKLPGPAPD KPNVYDFKTT YDQMYNDLLR KDKELYTQNG ILHMLDRNKR IKPRPERFQN CKDLFDLILT CEERVYDQVV EDLNSREQET CQPVHVVNVD IQDNHEEATL GAFLICELCQ CIQHTEDMEN EIDELLQEFE EKSGRTFLHT VCFY. It is sometimes possible for the material contained within the vial of "SSU72, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.