Mouse anti-Human SSU72 Polyclonal Antibody | anti-SSU72 antibody

SSU72 (RNA Polymerase II Subunit A C-terminal Domain Phosphatase SSU72, CTD Phosphatase SSU72, HSPC182, PNAS-120)

Cat. Num. AAA6008464

• Reactivity: Human
• Applications: Western Blot, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: SSU72; Polyclonal Antibody; SSU72 (RNA Polymerase II Subunit A C-terminal Domain Phosphatase SSU72; CTD Phosphatase SSU72; HSPC182; PNAS-120); Anti -SSU72 (RNA Polymerase II Subunit A C-terminal Domain Phosphatase SSU72; anti-SSU72 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human SSU72.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MPSSPLRVAVVCSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVDIQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQEFEEKSGRTFLHTVCFY

• Applicable Applications for anti-SSU72 antibody: Western Blot (WB), Immunofluorescence (IF)
• Application Notes: Suitable for use in Western Blot and Immunofluorescence.; Dilution: Immunofluorescence: 10ug/ml
• Immunogen: Full length human SSU72, aa1-194 (NP_054907.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SSU72 expression in transfected 293T cell line by SSU72 polyclonal antibody. Lane 1: SSU72 transfected lysate (21.34kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to SSU72 on HeLa cell. [antibody concentration 10ug/ml])

Product Categories/Family for anti-SSU72 antibody

Antibodies; Abs to RNA Processing

NCBI and Uniprot Product Information

• NCBI GI #: 1302241
• UniProt Accession #: P53538; Q6Q569; D6W0W8
• Molecular Weight: 23,469 Da
• NCBI Official Full Name: SSU72
• UniProt Protein Name: RNA polymerase II subunit A C-terminal domain phosphatase SSU72
• Protein Family: RNA polymerase II subunit A C-terminal domain phosphatase
• UniProt Gene Name: SSU72
• UniProt Synonym Gene Names: CTD phosphatase SSU72
• UniProt Entry Name: SSU72_YEAST

Uniprot Description

Function: Component of the cleavage and polyadenylation factor (CPF) complex, which plays a key role in polyadenylation-dependent pre-mRNA 3'-end formation and cooperates with cleavage factors including the CFIA complex and NAB4/CFIB. Component of the APT complex, which may be involved in polyadenylation-independent transcript 3'-end formation. SSU72 is required for 3'-end formation of snoRNAs. Ref.5 Ref.7Processively dephosphorylates Ser-5 of the heptad repeats YSPTSPS in the C-terminal domain of the largest RNA polymerase II subunit (RPB1). Ref.5 Ref.7

Catalytic activity: A phosphoprotein + H2O = a protein + phosphate.

Subunit structure: Component of the cleavage and polyadenylation factor (CPF) complex, which is composed of PTI1, SYC1, SSU72, GLC7, MPE1, REF2, PFS2, PTA1, YSH1/BRR5, SWD2, CFT2/YDH1, YTH1, CFT1/YHH1, FIP1 and PAP1. Component of the APT complex, which is a subcomplex of CPF, and is composed of PTI1, SYC1, SSU72, GLC7, REF2, PTA1 and SWD2. Ref.6

Subcellular location: Nucleus Ref.6.

Sequence similarities: Belongs to the SSU72 phosphatase family.