Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SSTR4 AntibodyTitration: 1.25 ug/mlPositive Control: Jurkat Whole Cell)

Rabbit SSTR4 Polyclonal Antibody | anti-SSTR4 antibody

SSTR4 antibody - middle region

Gene Names
SSTR4; SS4R; SS4-R; SS-4-R
Reactivity
Mouse, Rabbit
Applications
Western Blot
Purity
Protein A purified
Synonyms
SSTR4; Polyclonal Antibody; SSTR4 antibody - middle region; anti-SSTR4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse, Rabbit
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AKLINLGVWLASLLVTLPIAIFADTRPARGGQAVACNLQWPHPAWSAVFV
Sequence Length
388
Applicable Applications for anti-SSTR4 antibody
Western Blot (WB)
Homology
Mouse: 85%; Rabbit: 78%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SSTR4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SSTR4 AntibodyTitration: 1.25 ug/mlPositive Control: Jurkat Whole Cell)

Western Blot (WB) (WB Suggested Anti-SSTR4 AntibodyTitration: 1.25 ug/mlPositive Control: Jurkat Whole Cell)
Related Product Information for anti-SSTR4 antibody
This is a rabbit polyclonal antibody against SSTR4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Somatostatin acts at many sites to inhibit the release of many hormones and other secretory proteins. The biologic effects of somatostatin are probably mediated by a family of G protein-coupled receptors that are expressed in a tissue-specific manner. SSTR4 is a member of the superfamily of receptors having seven transmembrane segments and is expressed in highest levels in fetal and adult brain and lung.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
somatostatin receptor type 4
NCBI Official Synonym Full Names
somatostatin receptor 4
NCBI Official Symbol
SSTR4
NCBI Official Synonym Symbols
SS4R; SS4-R; SS-4-R
NCBI Protein Information
somatostatin receptor type 4
UniProt Protein Name
Somatostatin receptor type 4
Protein Family
UniProt Gene Name
SSTR4
UniProt Synonym Gene Names
SS-4-R; SS4-R; SS4R
UniProt Entry Name
SSR4_HUMAN

NCBI Description

Somatostatin acts at many sites to inhibit the release of many hormones and other secretory proteins. The biologic effects of somatostatin are probably mediated by a family of G protein-coupled receptors that are expressed in a tissue-specific manner. SSTR4 is a member of the superfamily of receptors having seven transmembrane segments and is expressed in highest levels in fetal and adult brain and lung. [provided by RefSeq, Jul 2008]

Uniprot Description

SSTR4: Receptor for somatostatin-14. The activity of this receptor is mediated by G proteins which inhibits adenylyl cyclase. It is functionally coupled not only to inhibition of adenylate cyclase, but also to activation of both arachidonate release and mitogen-activated protein (MAP) kinase cascade. Mediates antiproliferative action of somatostatin in tumor cells. Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1; Membrane protein, integral; Receptor, GPCR; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 20p11.2

Cellular Component: neuron projection; integral to plasma membrane; cytoplasm; plasma membrane

Molecular Function: neuropeptide binding; somatostatin receptor activity

Biological Process: synaptic transmission; G-protein coupled receptor protein signaling pathway; negative regulation of cell proliferation; G-protein signaling, coupled to cyclic nucleotide second messenger; cell migration; positive regulation of MAPKKK cascade; neuropeptide signaling pathway; forebrain development; arachidonic acid metabolic process; negative regulation of cAMP metabolic process

Research Articles on SSTR4

Similar Products

Product Notes

The SSTR4 sstr4 (Catalog #AAA3201474) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SSTR4 antibody - middle region reacts with Mouse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's SSTR4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SSTR4 sstr4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AKLINLGVWL ASLLVTLPIA IFADTRPARG GQAVACNLQW PHPAWSAVFV. It is sometimes possible for the material contained within the vial of "SSTR4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.