Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SSR5Sample Tissue: Human Large Intestine Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit SSR5 Polyclonal Antibody | anti-SSTR5 antibody

SSR5 Antibody - middle region

Gene Names
SSTR5; SS-5-R
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Purity
Affinity purified
Synonyms
SSR5; Polyclonal Antibody; SSR5 Antibody - middle region; anti-SSTR5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FAPLLVICLCYLLIVVKVRAAGVRVGCVRRRSERKVTRMVLVVVLVFAGC
Sequence Length
364
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 77%; Rat: 100%; Sheep: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SSR5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SSR5Sample Tissue: Human Large Intestine Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SSR5Sample Tissue: Human Large Intestine Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SSTR5 antibody
somatostatin receptor 5

Target Description: Somatostatin and its related peptide cortistatin exert multiple biological actions on normal and tumoral tissue targets by interacting with somatostatin receptors (SSTRs). The protein encoded by this gene is one of the SSTRs, which is a multi-pass membrane protein and belongs to the G-protein coupled receptor 1 family. The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase, and different regions of this receptor molecule are required for the activation of different signaling pathways. A mutation in this gene results in somatostatin analog resistance. Alternatively spliced transcript variants have been identified in this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40 kDa
NCBI Official Full Name
somatostatin receptor type 5
NCBI Official Synonym Full Names
somatostatin receptor 5
NCBI Official Symbol
SSTR5
NCBI Official Synonym Symbols
SS-5-R
NCBI Protein Information
somatostatin receptor type 5
UniProt Protein Name
Somatostatin receptor type 5
Protein Family
UniProt Gene Name
SSTR5
UniProt Synonym Gene Names
SS-5-R; SS5-R; SS5R
UniProt Entry Name
SSR5_HUMAN

NCBI Description

Somatostatin and its related peptide cortistatin exert multiple biological actions on normal and tumoral tissue targets by interacting with somatostatin receptors (SSTRs). The protein encoded by this gene is one of the SSTRs, which is a multi-pass membrane protein and belongs to the G-protein coupled receptor 1 family. The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase, and different regions of this receptor molecule are required for the activation of different signaling pathways. A mutation in this gene results in somatostatin analog resistance. Alternatively spliced transcript variants have been identified in this gene.[provided by RefSeq, Feb 2010]

Uniprot Description

SSTR5: Receptor for somatostatin 28 and to a lesser extent for somatostatin-14. The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, multi-pass; GPCR, family 1; Cell cycle regulation; Receptor, GPCR; Membrane protein, integral

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: neuron projection; integral to plasma membrane; plasma membrane

Molecular Function: neuropeptide binding; somatostatin receptor activity

Biological Process: positive regulation of cytokinesis; negative regulation of cell proliferation; G-protein signaling, coupled to cyclic nucleotide second messenger; synaptic transmission; G-protein coupled receptor protein signaling pathway; neuropeptide signaling pathway; glucose homeostasis; regulation of insulin secretion

Disease: Pituitary Adenoma, Growth Hormone-secreting

Research Articles on SSTR5

Similar Products

Product Notes

The SSTR5 sstr5 (Catalog #AAA3214398) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SSR5 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: FAPLLVICLC YLLIVVKVRA AGVRVGCVRR RSERKVTRMV LVVVLVFAGC. It is sometimes possible for the material contained within the vial of "SSR5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.