Mouse anti-Human SSPN Polyclonal Antibody | anti-Sspn antibody

SSPN (Sarcospan, K-ras Oncogene-associated Protein, Kirsten-ras-associated Protein, KRAG)

Cat. Num. AAA6005537

• Gene Names: Sspn; Krag
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: SSPN; Polyclonal Antibody; SSPN (Sarcospan; K-ras Oncogene-associated Protein; Kirsten-ras-associated Protein; KRAG); Anti -SSPN (Sarcospan; anti-Sspn antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human SSPN.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Concentration: 0.42 mg/ml (varies by lot)
• Sequence: MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQLALGIAVTVVGFLMASISSSLLVRDTPFWAGIIVCLVAYLGLFMLCVSYQVDERTCIQFSMKLLYFLLSALGLTVCVLAVAFAAHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKLFLLIQMILNLVCGLVCLLACFVMWKHRYQVFYVGVRICSLTASEGPQQKI

• Applicable Applications for anti-Sspn antibody: Suitable for use in Western Blot (WB). Other applications not tested.
• Application Notes: Optimal dilutions to be determined by the researcher.
• Immunogen: Full length protein corresponding to aa1-243 from human SSPN.
• Preparation and Storage: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SSPN expression in human colon using MBS6005537.)

Western Blot (WB)

(Western Blot analysis of SSPN expression in transfected 293T cell line using MBS6005537. Lane 1: SSPN transfected lysate (26.73kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-Sspn antibody

Component of the dystrophin-glycoprotein complex (DGC), a complex that spans the muscle plasma membrane and forms a link between the F-actin cytoskeleton and the extracellular matrix. Preferentially associates with the sarcoglycan subcomplex of the DGC.

Product Categories/Family for anti-Sspn antibody

Antibodies; Abs to Oncoproteins

NCBI and Uniprot Product Information

• NCBI GI #: 6754476
• NCBI GeneID: 16651
• NCBI Accession #: NP_005086.3
• NCBI GenBank Nucleotide #: NM_010656.2
• UniProt Accession #: Q62147; Q60594
• NCBI Official Full Name: sarcospan
• NCBI Official Synonym Full Names: sarcospan
• NCBI Official Symbol: Sspn
• NCBI Official Synonym Symbols: Krag
• NCBI Protein Information: sarcospan; Kras oncogene-associated; kirsten-Ras-associated protein; K-ras oncogene-associated protein
• UniProt Protein Name: Sarcospan
• Protein Family: Sarcospan
• UniProt Gene Name: Sspn
• UniProt Synonym Gene Names: Krag
• UniProt Entry Name: SSPN_MOUSE

Uniprot Description

SSPN: Component of the dystrophin-glycoprotein complex (DGC), a complex that spans the muscle plasma membrane and forms a link between the F-actin cytoskeleton and the extracellular matrix. Preferentially associates with the sarcoglycan subcomplex of the DGC. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Membrane protein, multi-pass; Membrane protein, integral

Cellular Component: postsynaptic membrane; transport vesicle; membrane; integral to membrane; plasma membrane; synapse; cell junction; sarcolemma