Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Pancreas)

Rabbit SQSTM1 Polyclonal Antibody | anti-SQSTM1 antibody

SQSTM1 antibody - middle region

Gene Names
SQSTM1; p60; p62; A170; DMRV; OSIL; PDB3; ZIP3; p62B; NADGP; FTDALS3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
SQSTM1; Polyclonal Antibody; SQSTM1 antibody - middle region; anti-SQSTM1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPESEGPSSLDPSQE
Sequence Length
440
Applicable Applications for anti-SQSTM1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SQSTM1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Pancreas)

Immunohistochemistry (IHC) (Pancreas)

Immunohistochemistry (IHC)

(Rabbit Anti-SQSTM1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Thyroid Gland TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-SQSTM1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Thyroid Gland TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(Host: MouseTarget Name: SQSTM1Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: SQSTM1Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: SQSTM1Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SQSTM1Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: SQSTM1Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SQSTM1Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: SQSTM1Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SQSTM1Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-SQSTM1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Pancreas)

Western Blot (WB) (WB Suggested Anti-SQSTM1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Pancreas)
Related Product Information for anti-SQSTM1 antibody
This is a rabbit polyclonal antibody against SQSTM1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a multifunctional protein that binds ubiquitin and regulates activation of the nuclear factor kappa-B (NF-kB) signaling pathway. The protein functions as a scaffolding/adaptor protein in concert with TNF receptor-associated factor 6 to m

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
Sequestosome-1
NCBI Official Synonym Full Names
sequestosome 1
NCBI Official Symbol
SQSTM1
NCBI Official Synonym Symbols
p60; p62; A170; DMRV; OSIL; PDB3; ZIP3; p62B; NADGP; FTDALS3
NCBI Protein Information
sequestosome-1
UniProt Protein Name
Sequestosome-1
Protein Family
UniProt Gene Name
SQSTM1
UniProt Synonym Gene Names
ORCA; OSIL; EBIAP; p60
UniProt Entry Name
SQSTM_HUMAN

NCBI Description

This gene encodes a multifunctional protein that binds ubiquitin and regulates activation of the nuclear factor kappa-B (NF-kB) signaling pathway. The protein functions as a scaffolding/adaptor protein in concert with TNF receptor-associated factor 6 to mediate activation of NF-kB in response to upstream signals. Alternatively spliced transcript variants encoding either the same or different isoforms have been identified for this gene. Mutations in this gene result in sporadic and familial Paget disease of bone. [provided by RefSeq, Mar 2009]

Uniprot Description

SQSTM1: an adapter protein which binds ubiquitin, shuttling proteins to the proteasome. Co-localizes along with the E3 ubiquitin ligase, TRAF6, to aggregates from Alzheimer's disease brains but not in control brain. May regulate the activation of NFKB1 by TNF-alpha, nerve growth factor (NGF) and interleukin-1. May play a role in titin downstream signaling in muscle cells. May regulate signaling cascades through ubiquitination. May be involved in cell differentiation, apoptosis, immune response and regulation of K(+) channels. Forms ternary complexes with PKCZ and Kv-beta2 or PKCZ and GABBR3. Also interacts with KCNAB1, GABRR1, GABRR2 and GABRR3. Interacts with EBI3, LCK, RASA1, PKCZ , PKCI, NR2F2, NTRK1, NTRK2, NTRK3, NBR1, MEK5, TRIM55 and MAPKAPK5. Interacts with the proteasome subunits PSMD4 and PSMC2. Interacts with K63- polyubiquitinated MAPT/TAU. Interacts with IKBKB through PRKCZ and PRKCI. Interacts with NGFR through TRAF6 and bridges that complex to NTRK1. Forms a complex with MEK5 and PRKCZ or PRKCI. Component of a ternary complex with PAWR and PRKCZ. Upon TNF-alpha stimulation, interacts with RIPK1 problably bridging IKBKB to the TNF-R1 complex composed of TNF-R1/TNFRSF1A, TRADD and RIPK1. Forms a complex with JUB/Ajuba, PRKCZ and TRAF6. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear receptor co-regulator; Autophagy; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 5q35

Cellular Component: nucleoplasm; PML body; endoplasmic reticulum; lysosome; cytoplasm; late endosome; autophagic vacuole; cytoplasmic vesicle; inclusion body; cytosol

Molecular Function: identical protein binding; protein serine/threonine kinase activity; protein binding; ubiquitin binding; protein homodimerization activity; protein kinase C binding; zinc ion binding; SH2 domain binding; receptor tyrosine kinase binding; protein kinase binding

Biological Process: regulation of Ras protein signal transduction; ubiquitin-dependent protein catabolic process; nerve growth factor receptor signaling pathway; immune system process; positive regulation of apoptosis; protein heterooligomerization; macroautophagy; endosome transport; protein amino acid phosphorylation; protein localization; response to stress; autophagy; positive regulation of transcription from RNA polymerase II promoter; positive regulation of protein amino acid phosphorylation; cell differentiation; regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of macroautophagy; negative regulation of apoptosis

Disease: Frontotemporal Dementia And/or Amyotrophic Lateral Sclerosis 3; Paget Disease Of Bone

Research Articles on SQSTM1

Similar Products

Product Notes

The SQSTM1 sqstm1 (Catalog #AAA3211560) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SQSTM1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SQSTM1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the SQSTM1 sqstm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EEQMESDNCS GGDDDWTHLS SKEVDPSTGE LQSLQMPESE GPSSLDPSQE. It is sometimes possible for the material contained within the vial of "SQSTM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.