Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SPON2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

Rabbit SPON2 Polyclonal Antibody | anti-SPON2 antibody

SPON2 antibody - N-terminal region

Gene Names
SPON2; DIL1; DIL-1; MINDIN; M-SPONDIN
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SPON2; Polyclonal Antibody; SPON2 antibody - N-terminal region; anti-SPON2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CSARAPAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMW
Sequence Length
331
Applicable Applications for anti-SPON2 antibody
Western Blot (WB)
Homology
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SPON2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SPON2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-SPON2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)
Related Product Information for anti-SPON2 antibody
This is a rabbit polyclonal antibody against SPON2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SPON2 is a cell adhesion protein that promote adhesion and outgrowth of hippocampal embryonic neurons. Binds directly to bacteria and their components and functions as an opsonin for macrophage phagocytosis of bacteria. It is essential in the initiation of the innate immune response and represents a unique pattern-recognition molecule in the ECM for microbial pathogens.
Product Categories/Family for anti-SPON2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
spondin-2
NCBI Official Synonym Full Names
spondin 2
NCBI Official Symbol
SPON2
NCBI Official Synonym Symbols
DIL1; DIL-1; MINDIN; M-SPONDIN
NCBI Protein Information
spondin-2
UniProt Protein Name
Spondin-2
Protein Family
UniProt Gene Name
SPON2
UniProt Synonym Gene Names
DIL1; DIL-1
UniProt Entry Name
SPON2_HUMAN

Uniprot Description

SPON2: Cell adhesion protein that promotes adhesion and outgrowth of hippocampal embryonic neurons. Binds directly to bacteria and their components and functions as an opsonin for macrophage phagocytosis of bacteria. Essential in the initiation of the innate immune response and represents a unique pattern- recognition molecule in the ECM for microbial pathogens. Binds bacterial lipopolysaccharide (LPS).

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 4p16.3

Cellular Component: extracellular space; proteinaceous extracellular matrix

Molecular Function: lipopolysaccharide binding; metal ion binding; antigen binding

Biological Process: induction of bacterial agglutination; mast cell mediated immunity; axon guidance; innate immune response; positive regulation of interleukin-6 production; opsonization; cell adhesion; positive regulation of tumor necrosis factor production; defense response to fungus; defense response to virus

Research Articles on SPON2

Similar Products

Product Notes

The SPON2 spon2 (Catalog #AAA3210739) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SPON2 antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SPON2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SPON2 spon2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CSARAPAKYS ITFTGKWSQT AFPKQYPLFR PPAQWSSLLG AAHSSDYSMW. It is sometimes possible for the material contained within the vial of "SPON2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.