Rabbit anti-Human, Mouse SPINK1 Polyclonal Antibody | anti-SPINK1 antibody

SPINK1 (Pancreatic Secretory Trypsin Inhibitor, Serine Protease Inhibitor Kazal-type 1, Tumor-associated Trypsin Inhibitor, TATI, PSTI) APC

Cat. Num. AAA6394939

• Gene Names: SPINK1; TCP; PCTT; PSTI; TATI; Spink3
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SPINK1; Polyclonal Antibody; SPINK1 (Pancreatic Secretory Trypsin Inhibitor; Serine Protease Inhibitor Kazal-type 1; Tumor-associated Trypsin Inhibitor; TATI; PSTI) APC; anti-SPINK1 antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human SPINK1. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-SPINK1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human SPINK1, aa1-79 (NP_003113.2).
• Immunogen Sequence: MKVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC
• Conjugate: APC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(SPINK1 rabbit polyclonal antibody. Western Blot analysis of SPINK1 expression in mouse kidney.)

Western Blot (WB)

(Western Blot analysis of SPINK1 expression in transfected 293T cell line by SPINK1 polyclonal antibody. Lane 1: SPINK1 transfected lysate (8.5kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-SPINK1 antibody

This is a trypsin inhibitor, its physiological function is to prevent the trypsin-catalyzed premature activation of zymogens within the pancreas.

Product Categories/Family for anti-SPINK1 antibody

Antibodies; Protease Inhibitors

NCBI and Uniprot Product Information

• NCBI GI #: 45505132
• NCBI GeneID: 6690
• NCBI Accession #: NP_003113.2
• NCBI GenBank Nucleotide #: NM_003122.2
• UniProt Accession #: P00995
• Molecular Weight: 8,507 Da
• NCBI Official Full Name: pancreatic secretory trypsin inhibitor
• NCBI Official Synonym Full Names: serine peptidase inhibitor, Kazal type 1
• NCBI Official Symbol: SPINK1
• NCBI Official Synonym Symbols: TCP; PCTT; PSTI; TATI; Spink3
• NCBI Protein Information: pancreatic secretory trypsin inhibitor; serine protease inhibitor, Kazal type 1; tumor-associated trypsin inhibitor
• UniProt Protein Name: Pancreatic secretory trypsin inhibitor
• Protein Family: Serine protease inhibitor
• UniProt Gene Name: SPINK1
• UniProt Synonym Gene Names: PSTI; TATI
• UniProt Entry Name: ISK1_HUMAN

NCBI Description

The protein encoded by this gene is a trypsin inhibitor, which is secreted from pancreatic acinar cells into pancreatic juice. It is thought to function in the prevention of trypsin-catalyzed premature activation of zymogens within the pancreas and the pancreatic duct. Mutations in this gene are associated with hereditary pancreatitis and tropical calcific pancreatitis. [provided by RefSeq, Oct 2008]

Uniprot Description

SPINK1: This is a trypsin inhibitor, its physiological function is to prevent the trypsin-catalyzed premature activation of zymogens within the pancreas. Defects in SPINK1 are a cause of pancreatitis (PCTT). A disease characterized by the presence of calculi in pancreatic ducts. It causes severe abdominal pain attacks. Defects in SPINK1 are the cause of susceptibility to tropical calcific pancreatitis (TCP). TCP is an idiopathic, juvenile, nonalcoholic form of chronic pancreatitis widely prevalent in several tropical countries. It can be associated with fibrocalculous pancreatic diabetes (FCPD) depending on both environmental and genetic factors. TCP differs from alcoholic pancreatitis by a much younger age of onset, pancreatic calcification, a high incidence of insulin dependent but ketosis resistant diabetes mellitus, and an exceptionally high incidence of pancreatic cancer.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 5q32

Cellular Component: extracellular space

Molecular Function: serine-type endopeptidase inhibitor activity; protein binding; endopeptidase inhibitor activity

Biological Process: negative regulation of peptidyl-tyrosine phosphorylation; regulation of acrosome reaction

Disease: Tropical Calcific Pancreatitis; Pancreatitis, Hereditary