Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SPDEF Antibody Titration: 2.5ug/mlELISA Titer: 1:12500Positive Control: MCF7 cell lysateSPDEF is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)

Rabbit SPDEF Polyclonal Antibody | anti-SPDEF antibody

SPDEF antibody - N-terminal region

Gene Names
SPDEF; PDEF; bA375E1.3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
SPDEF; Polyclonal Antibody; SPDEF antibody - N-terminal region; anti-SPDEF antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPEDSSWAAKAPGA
Sequence Length
335
Applicable Applications for anti-SPDEF antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 83%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SPDEF
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SPDEF Antibody Titration: 2.5ug/mlELISA Titer: 1:12500Positive Control: MCF7 cell lysateSPDEF is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)

Western Blot (WB) (WB Suggested Anti-SPDEF Antibody Titration: 2.5ug/mlELISA Titer: 1:12500Positive Control: MCF7 cell lysateSPDEF is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)
Related Product Information for anti-SPDEF antibody
This is a rabbit polyclonal antibody against SPDEF. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PDEF is an ETS transcription factor expressed in prostate epithelial cells. It acts as an androgen-independent transactivator of PSA expression.PDEF is an ETS transcription factor expressed in prostate epithelial cells. It acts as an androgen-independent transactivator of PSA (MIM 176820) expression.[supplied by OMIM].

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
SAM pointed domain-containing Ets transcription factor isoform 1
NCBI Official Synonym Full Names
SAM pointed domain containing ETS transcription factor
NCBI Official Symbol
SPDEF
NCBI Official Synonym Symbols
PDEF; bA375E1.3
NCBI Protein Information
SAM pointed domain-containing Ets transcription factor
UniProt Protein Name
SAM pointed domain-containing Ets transcription factor
UniProt Gene Name
SPDEF
UniProt Synonym Gene Names
PDEF; PSE; Prostate-specific Ets

NCBI Description

The protein encoded by this gene belongs to the ETS family of transcription factors. It is highly expressed in the prostate epithelial cells, and functions as an androgen-independent transactivator of prostate-specific antigen (PSA) promoter. Higher expression of this protein has also been reported in brain, breast, lung and ovarian tumors, compared to the corresponding normal tissues, and it shows better tumor-association than other cancer-associated molecules, making it a more suitable target for developing specific cancer therapies. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]

Uniprot Description

May function as an androgen-independent transactivator of the prostate-specific antigen (PSA) promoter. Binds to 5'-GGAT-3' DNA sequences. May play a role in the regulation of the prostate gland and/or prostate cancer development. Acts as a transcriptional activator for SERPINB5 promoter.

Research Articles on SPDEF

Similar Products

Product Notes

The SPDEF spdef (Catalog #AAA3200595) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SPDEF antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SPDEF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SPDEF spdef for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AAAGAVGLER RDWSPSPPAT PEQGLSAFYL SYFDMLYPED SSWAAKAPGA. It is sometimes possible for the material contained within the vial of "SPDEF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.