Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using SPATA7 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Rabbit SPATA7 Polyclonal Antibody | anti-SPATA7 antibody
SPATA7 Polyclonal Antibody
Gene Names
SPATA7; HSD3; LCA3; HSD-3.1; HEL-S-296
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
SPATA7; Polyclonal Antibody; SPATA7 Polyclonal Antibody; HEL-S-296; HSD-3.1; HSD3; LCA3; anti-SPATA7 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDDALQHSSPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEENSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNLETSTLDENHPSISDSLTDRETSVNVIEGDSDPEKVEISN
Sequence Length
567
Applicable Applications for anti-SPATA7 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human SPATA7
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm, cilium axoneme, cilium basal body, cytoskeleton
Positive Samples
U-87MG, Mouse testis, Mouse brain, Rat brain
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using SPATA7 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using SPATA7 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Related Product Information for anti-SPATA7 antibody
This gene, originally isolated from testis, is also expressed in retina. Mutations in this gene are associated with Leber congenital amaurosis and juvenile retinitis pigmentosa. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-SPATA7 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 51kDa; 64kDa; 67kDa
Observed: 75kDa
Observed: 75kDa
NCBI Official Full Name
spermatogenesis-associated protein 7 isoform 2
NCBI Official Synonym Full Names
spermatogenesis associated 7
NCBI Official Symbol
SPATA7
NCBI Official Synonym Symbols
HSD3; LCA3; HSD-3.1; HEL-S-296
NCBI Protein Information
spermatogenesis-associated protein 7
UniProt Protein Name
Spermatogenesis-associated protein 7
Protein Family
UniProt Gene Name
SPATA7
UniProt Synonym Gene Names
HSD3
NCBI Description
This gene, originally isolated from testis, is also expressed in retina. Mutations in this gene are associated with Leber congenital amaurosis and juvenile retinitis pigmentosa. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2010]
Uniprot Description
Involved in photoreceptor cells maintenance (). It is required for recruitment and proper localization of RPGRIP1 to the photoreceptor connecting cilium (CC), as well as protein trafficking across the CC to the outer segments ().
Research Articles on SPATA7
Similar Products
Product Notes
The SPATA7 spata7 (Catalog #AAA9134290) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SPATA7 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SPATA7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the SPATA7 spata7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MNIKQASNCV TYDAKEKIAP LPLEGHDSTW DEIKDDALQH SSPRAMCQYS LKPPSTRKIY SDEEELLYLS FIEDVTDEIL KLGLFSNRFL ERLFERHIKQ NKHLEEEKMR HLLHVLKVDL GCTSEENSVK QNDVDMLNVF DFEKAGNSEP NELKNESEVT IQQERQQYQK ALDMLLSAPK DENEIFPSPT EFFMPIYKSK HSEGVIIQQV NDETNLETST LDENHPSISD SLTDRETSVN VIEGDSDPEK VEISN. It is sometimes possible for the material contained within the vial of "SPATA7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
