Western Blot (WB)
(Host: RabbitTarget Name: SPATA6Sample Tissue: Human HCT116Antibody Dilution: 1.0ug/ml)
Rabbit SPATA6 Polyclonal Antibody | anti-SPATA6 antibody
SPATA6 antibody - middle region
Gene Names
SPATA6; HASH; SRF1; SRF-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SPATA6; Polyclonal Antibody; SPATA6 antibody - middle region; anti-SPATA6 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SQKKKSKSPERSKYCINAKNYEQPTISSKSHSPSPYTKRRMCELSEDTRR
Sequence Length
488
Applicable Applications for anti-SPATA6 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SPATA6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: SPATA6Sample Tissue: Human HCT116Antibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: SPATA6Sample Tissue: Human HCT116Antibody Dilution: 1.0ug/ml)
Western Blot (WB)
(WB Suggested Anti-SPATA6 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Western Blot (WB)
(WB Suggested Anti-SPATA6 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-SPATA6 antibody
This is a rabbit polyclonal antibody against SPATA6. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: SPATA6 belongs to the SPATA6 family. SPATA6 may play a role in spermatid maturation or sperm function.
Target Description: SPATA6 belongs to the SPATA6 family. SPATA6 may play a role in spermatid maturation or sperm function.
Product Categories/Family for anti-SPATA6 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
spermatogenesis-associated protein 6 isoform 1
NCBI Official Synonym Full Names
spermatogenesis associated 6
NCBI Official Symbol
SPATA6
NCBI Official Synonym Symbols
HASH; SRF1; SRF-1
NCBI Protein Information
spermatogenesis-associated protein 6
UniProt Protein Name
Spermatogenesis-associated protein 6
Protein Family
UniProt Gene Name
SPATA6
UniProt Entry Name
SPAT6_HUMAN
Uniprot Description
SPATA6: May play a role in spermatid maturation or sperm function. Belongs to the SPATA6 family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Secreted; Secreted, signal peptide
Chromosomal Location of Human Ortholog: 1p33
Cellular Component: extracellular region
Biological Process: multicellular organismal development; spermatogenesis; cell differentiation
Research Articles on SPATA6
Similar Products
Product Notes
The SPATA6 spata6 (Catalog #AAA3211481) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SPATA6 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SPATA6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SPATA6 spata6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SQKKKSKSPE RSKYCINAKN YEQPTISSKS HSPSPYTKRR MCELSEDTRR. It is sometimes possible for the material contained within the vial of "SPATA6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
