Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SPAG1Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)

Rabbit anti-Dog, Human SPAG1 Polyclonal Antibody | anti-SPAG1 antibody

SPAG1 Antibody - N-terminal region

Gene Names
SPAG1; SP75; TPIS; CT140; CILD28; HSD-3.8; HEL-S-268
Reactivity
Dog, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SPAG1; Polyclonal Antibody; SPAG1 Antibody - N-terminal region; anti-SPAG1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LHVGKEKYSKRPTKKKTPRDYAEWDKFDVEKECLKIDEDYKEKTVIDKSH
Sequence Length
416
Applicable Applications for anti-SPAG1 antibody
Western Blot (WB)
Homology
Dog: 85%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human SPAG1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SPAG1Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SPAG1Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-SPAG1 antibody
This is a rabbit polyclonal antibody against SPAG1. It was validated on Western Blot

Target Description: The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved identification and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. The protein expressed by this gene is recognized by anti-sperm agglutinating antibodies from an infertile woman. Furthermore, immunization of female rats with the recombinant human protein reduced fertility. This protein localizes to the plasma membrane of germ cells in the testis and to the post-acrosomal plasma membrane of mature spermatozoa. Recombinant polypeptide binds GTP and exhibits GTPase activity. Thus, this protein may regulate GTP signal transduction pathways involved in spermatogenesis and fertilization. Two transcript variants of this gene encode the same protein.
Product Categories/Family for anti-SPAG1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
sperm-associated antigen 1
NCBI Official Synonym Full Names
sperm associated antigen 1
NCBI Official Symbol
SPAG1
NCBI Official Synonym Symbols
SP75; TPIS; CT140; CILD28; HSD-3.8; HEL-S-268
NCBI Protein Information
sperm-associated antigen 1
Protein Family

NCBI Description

The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. The protein expressed by this gene is recognized by anti-sperm agglutinating antibodies from an infertile woman. Furthermore, immunization of female rats with the recombinant human protein reduced fertility. This protein localizes to the plasma membrane of germ cells in the testis and to the post-acrosomal plasma membrane of mature spermatozoa. Recombinant polypeptide binds GTP and exhibits GTPase activity. Thus, this protein may regulate GTP signal transduction pathways involved in spermatogenesis and fertilization. Two transcript variants of this gene encode the same protein. [provided by RefSeq, Jul 2008]

Research Articles on SPAG1

Similar Products

Product Notes

The SPAG1 (Catalog #AAA3216878) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SPAG1 Antibody - N-terminal region reacts with Dog, Human and may cross-react with other species as described in the data sheet. AAA Biotech's SPAG1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SPAG1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LHVGKEKYSK RPTKKKTPRD YAEWDKFDVE KECLKIDEDY KEKTVIDKSH. It is sometimes possible for the material contained within the vial of "SPAG1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.