Western Blot (WB)
(WB Suggested Anti-SPACA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: NCI-H226 cell lysateSPACA1 is supported by BioGPS gene expression data to be expressed in NCIH226)
Rabbit anti-Human SPACA1 Polyclonal Antibody | anti-SPACA1 antibody
SPACA1 antibody - N-terminal region
Gene Names
SPACA1; SAMP32
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SPACA1; Polyclonal Antibody; SPACA1 antibody - N-terminal region; anti-SPACA1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TENNDSETAENYAPPETEDVSNRNVVKEVEFGMCTVTCGIGVREVILTNG
Sequence Length
294
Applicable Applications for anti-SPACA1 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SPACA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-SPACA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: NCI-H226 cell lysateSPACA1 is supported by BioGPS gene expression data to be expressed in NCIH226)
Western Blot (WB)
(WB Suggested Anti-SPACA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: NCI-H226 cell lysateSPACA1 is supported by BioGPS gene expression data to be expressed in NCIH226)
Related Product Information for anti-SPACA1 antibody
This is a rabbit polyclonal antibody against SPACA1. It was validated on Western Blot
Target Description: The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved identification and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. The protein expressed by this gene is recognized by anti-sperm antibodies from infertile males. Furthermore, antibodies generated against the recombinant protein block in vitro fertilization. This protein localizes to the acrosomal membrane of spermatids and mature spermatozoa where it is thought to play a role in acrosomal morphogenesis and in sperm-egg binding and fusion, respectively.
Target Description: The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved identification and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. The protein expressed by this gene is recognized by anti-sperm antibodies from infertile males. Furthermore, antibodies generated against the recombinant protein block in vitro fertilization. This protein localizes to the acrosomal membrane of spermatids and mature spermatozoa where it is thought to play a role in acrosomal morphogenesis and in sperm-egg binding and fusion, respectively.
Product Categories/Family for anti-SPACA1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
sperm acrosome membrane-associated protein 1
NCBI Official Synonym Full Names
sperm acrosome associated 1
NCBI Official Symbol
SPACA1
NCBI Official Synonym Symbols
SAMP32
NCBI Protein Information
sperm acrosome membrane-associated protein 1
UniProt Protein Name
Sperm acrosome membrane-associated protein 1
Protein Family
UniProt Gene Name
SPACA1
UniProt Synonym Gene Names
SAMP32
UniProt Entry Name
SACA1_HUMAN
NCBI Description
The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. The protein expressed by this gene is recognized by anti-sperm antibodies from infertile males. Furthermore, antibodies generated against the recombinant protein block in vitro fertilization. This protein localizes to the acrosomal membrane of spermatids and mature spermatozoa where it is thought to play a role in acrosomal morphogenesis and in sperm-egg binding and fusion, respectively. [provided by RefSeq, Jul 2008]
Research Articles on SPACA1
Similar Products
Product Notes
The SPACA1 spaca1 (Catalog #AAA3209734) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SPACA1 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SPACA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SPACA1 spaca1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TENNDSETAE NYAPPETEDV SNRNVVKEVE FGMCTVTCGI GVREVILTNG. It is sometimes possible for the material contained within the vial of "SPACA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
