Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Flow Cytometry (FC/FACS) (Researcher: Dr. Ade Kallas, University of tartuApplication: Flow CytometrySpecies + Tissue/Cell type: A. Human H9 cells and B. Human H9 cells+Na+ButyratePrimary antibody dilution: 2ug+1x106 cellsSecondary antibody: Chicken anti rabbit-Alexa Fluor 488Secondary antibody dilution: 1:1000)

Rabbit SOX17 Polyclonal Antibody | anti-SOX17 antibody

SOX17 antibody - middle region

Gene Names
SOX17; VUR3
Reactivity
Dog, Guinea Pig, Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Flow Cytometry, Functional Assay
Purity
Affinity Purified
Synonyms
SOX17; Polyclonal Antibody; SOX17 antibody - middle region; anti-SOX17 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RTEFEQYLHFVCKPEMGLPYQGHDSGVNLPDSHGAISSVVSDASSAVYYC
Sequence Length
414
Applicable Applications for anti-SOX17 antibody
Western Blot (WB), Immunohistochemistry (IHC), Flow Cytometry (FC/FACS)
Homology
Dog: 86%; Guinea Pig: 93%; Human: 100%; Mouse: 86%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SOX17
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Flow Cytometry (FC/FACS)

(Researcher: Dr. Ade Kallas, University of tartuApplication: Flow CytometrySpecies + Tissue/Cell type: A. Human H9 cells and B. Human H9 cells+Na+ButyratePrimary antibody dilution: 2ug+1x106 cellsSecondary antibody: Chicken anti rabbit-Alexa Fluor 488Secondary antibody dilution: 1:1000)

Flow Cytometry (FC/FACS) (Researcher: Dr. Ade Kallas, University of tartuApplication: Flow CytometrySpecies + Tissue/Cell type: A. Human H9 cells and B. Human H9 cells+Na+ButyratePrimary antibody dilution: 2ug+1x106 cellsSecondary antibody: Chicken anti rabbit-Alexa Fluor 488Secondary antibody dilution: 1:1000)

Immunohistochemistry (IHC)

(Rabbit Anti-SOX17 AntibodyParaffin Embedded Tissue: Human KidneyAntibody Concentration: 5 ug/ml)

Immunohistochemistry (IHC) (Rabbit Anti-SOX17 AntibodyParaffin Embedded Tissue: Human KidneyAntibody Concentration: 5 ug/ml)

Western Blot (WB)

(WB Suggested Anti-SOX17 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)

Western Blot (WB) (WB Suggested Anti-SOX17 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)
Related Product Information for anti-SOX17 antibody
This is a rabbit polyclonal antibody against SOX17. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The SOX17 gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
transcription factor SOX-17
NCBI Official Synonym Full Names
SRY-box 17
NCBI Official Symbol
SOX17
NCBI Official Synonym Symbols
VUR3
NCBI Protein Information
transcription factor SOX-17
UniProt Protein Name
Transcription factor SOX-17
Protein Family
UniProt Gene Name
SOX17
UniProt Entry Name
SOX17_HUMAN

NCBI Description

This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. [provided by RefSeq, Jul 2008]

Uniprot Description

SOX17: Acts as transcription regulator that binds target promoter DNA and bends the DNA. Binds to the sequences 5'- AACAAT-'3 or 5'-AACAAAG-3'. Modulates transcriptional regulation via WNT3A. Inhibits Wnt signaling. Promotes degradation of activated CTNNB1. Plays a key role in the regulation of embryonic development. Required for normal looping of the embryonic heart tube. Required for normal development of the definitive gut endoderm. Probable transcriptional activator in the premeiotic germ cells. Defects in SOX17 are the cause of vesicoureteral reflux type 3 (VUR3). VUR3 is a disease belonging to the group of congenital anomalies of the kidney and urinary tract. It is characterized by the reflux of urine from the bladder into the ureters and sometimes into the kidneys, and is a risk factor for urinary tract infections. Primary disease results from a developmental defect of the ureterovesical junction. In combination with intrarenal reflux, the resulting inflammatory reaction may result in renal injury or scarring, also called reflux nephropathy. Extensive renal scarring impairs renal function and may predispose patients to hypertension, proteinuria, renal insufficiency and end-stage renal disease.

Protein type: Transcription regulation; DNA-binding

Chromosomal Location of Human Ortholog: 8q11.23

Cellular Component: transcription factor complex; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; protein binding; protein heterodimerization activity; sequence-specific DNA binding; transcription coactivator activity; beta-catenin binding; transcription factor binding

Biological Process: endodermal cell fate determination; positive regulation of transcription, DNA-dependent; regulation of embryonic development; stem cell fate specification; Wnt receptor signaling pathway through beta-catenin; negative regulation of transcription from RNA polymerase II promoter; rostrocaudal neural tube patterning; regulation of transcription, DNA-dependent; negative regulation of mesodermal cell fate specification; embryonic foregut morphogenesis; inner cell mass cellular morphogenesis; heart looping; angiogenesis; vasculogenesis; cell migration involved in gastrulation; protein stabilization; protein destabilization; positive regulation of skeletal muscle development; mRNA transcription from RNA polymerase II promoter; endoderm formation; positive regulation of protein catabolic process; embryonic heart tube development; positive regulation of transcription from RNA polymerase II promoter; spermatogenesis; negative regulation of cell growth; positive regulation of cell differentiation

Disease: Vesicoureteral Reflux 3

Research Articles on SOX17

Similar Products

Product Notes

The SOX17 sox17 (Catalog #AAA3204696) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SOX17 antibody - middle region reacts with Dog, Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SOX17 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Flow Cytometry (FC/FACS). Researchers should empirically determine the suitability of the SOX17 sox17 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RTEFEQYLHF VCKPEMGLPY QGHDSGVNLP DSHGAISSVV SDASSAVYYC. It is sometimes possible for the material contained within the vial of "SOX17, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.