Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SOD2 rabbit polyclonal antibody. Western Blot analysis of SOD2 expression in human liver.)

Rabbit anti-Human SOD2 Polyclonal Antibody | anti-SOD2 antibody

SOD2 (Superoxide Dismutase [Mn], Mitochondrial) (PE)

Gene Names
SOD2; IPOB; MNSOD; MVCD6
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SOD2; Polyclonal Antibody; SOD2 (Superoxide Dismutase [Mn]; Mitochondrial) (PE); anti-SOD2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SOD2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-SOD2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human SOD2, aa1-222 (AAH12423.1).
Immunogen Sequence
MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(SOD2 rabbit polyclonal antibody. Western Blot analysis of SOD2 expression in human liver.)

Western Blot (WB) (SOD2 rabbit polyclonal antibody. Western Blot analysis of SOD2 expression in human liver.)

Western Blot (WB)

(Western Blot analysis of SOD2 expression in transfected 293T cell line by SOD2 polyclonal antibody. Lane 1: SOD2 transfected lysate (24.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SOD2 expression in transfected 293T cell line by SOD2 polyclonal antibody. Lane 1: SOD2 transfected lysate (24.8kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-SOD2 antibody
SOD2 is a member of the iron/manganese superoxide dismutase family. It is a mitochondrial matrix protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this protein have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer. Recombinant human SOD2 protein was expressed in E. coli.
Product Categories/Family for anti-SOD2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,722 Da
NCBI Official Full Name
Superoxide dismutase 2, mitochondrial
NCBI Official Synonym Full Names
superoxide dismutase 2, mitochondrial
NCBI Official Symbol
SOD2
NCBI Official Synonym Symbols
IPOB; MNSOD; MVCD6
NCBI Protein Information
superoxide dismutase [Mn], mitochondrial; superoxide dismutase [Mn], mitochondrial; indophenoloxidase B; Mn superoxide dismutase; mangano-superoxide dismutase; manganese-containing superoxide dismutase
UniProt Protein Name
Superoxide dismutase [Mn], mitochondrial
Protein Family
UniProt Gene Name
SOD2
UniProt Entry Name
SODM_HUMAN

Uniprot Description

SOD2: Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems. Genetic variation in SOD2 is associated with susceptibility to microvascular complications of diabetes type 6 (MVCD6). These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new- onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis. Belongs to the iron/manganese superoxide dismutase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Mitochondrial; EC 1.15.1.1; Oxidoreductase

Chromosomal Location of Human Ortholog: 6q25.3

Cellular Component: mitochondrion; mitochondrial matrix; mitochondrial inner membrane

Molecular Function: identical protein binding; DNA binding; manganese ion binding; superoxide dismutase activity; oxygen binding

Biological Process: oxygen homeostasis; positive regulation of nitric oxide biosynthetic process; removal of superoxide radicals; heart development; locomotory behavior; response to lipopolysaccharide; response to L-ascorbic acid; post-embryonic development; protein homotetramerization; negative regulation of cell proliferation; response to selenium ion; glutathione metabolic process; regulation of mitochondrial membrane potential; acetylcholine vasodilation involved in regulation of systemic arterial blood pressure; regulation of catalytic activity; regulation of blood pressure; response to gamma radiation; hemopoiesis; negative regulation of neuron apoptosis; response to axon injury; response to electrical stimulus; response to drug; erythrophore differentiation; release of cytochrome c from mitochondria; response to superoxide; superoxide metabolic process; liver development; negative regulation of fat cell differentiation; response to manganese ion; regulation of transcription from RNA polymerase II promoter; response to silicon dioxide; response to reactive oxygen species; iron ion homeostasis; response to hyperoxia; response to cadmium ion; response to hydrogen peroxide; DNA damage response, signal transduction resulting in induction of apoptosis; age-dependent response to reactive oxygen species; detection of oxygen; response to zinc ion; negative regulation of fibroblast proliferation; response to hypoxia; neuron development; response to activity; response to cold; induction of apoptosis by oxidative stress; superoxide release; hydrogen peroxide biosynthetic process

Disease: Microvascular Complications Of Diabetes, Susceptibility To, 6

Similar Products

Product Notes

The SOD2 sod2 (Catalog #AAA6394783) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SOD2 (Superoxide Dismutase [Mn], Mitochondrial) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SOD2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SOD2 sod2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SOD2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.