Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SOCS7Sample Type: Breast Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit SOCS7 Polyclonal Antibody | anti-SOCS7 antibody

SOCS7 Antibody - N-terminal region

Gene Names
SOCS7; NAP4; NCKAP4
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SOCS7; Polyclonal Antibody; SOCS7 Antibody - N-terminal region; anti-SOCS7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GSAGRELDAGRKPKLTRTQSAFSPVSFSPLFTGETVSLVDVDISQRGLTS
Sequence Length
331
Applicable Applications for anti-SOCS7 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 92%; Guinea Pig: 83%; Horse: 100%; Human: 100%; Mouse: 85%; Pig: 92%; Rabbit: 100%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SOCS7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SOCS7Sample Type: Breast Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SOCS7Sample Type: Breast Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SOCS7 antibody
This is a rabbit polyclonal antibody against SOCS7. It was validated on Western Blot

Target Description: SOCS7 regulates signaling cascades probably through protein ubiquitination and/or sequestration. It functions in insulin signaling and glucose homeostasis through IRS1 ubiquitination and subsequent proteasomal degradation. It inhibits also prolactin, growth hormone and leptin signaling by preventing STAT3 and STAT5 activation, sequestering them in the cytoplasm and reducing their binding to DNA. SOCS7 may be a substrate recognition component of a SCF-like E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
suppressor of cytokine signaling 7
NCBI Official Synonym Full Names
suppressor of cytokine signaling 7
NCBI Official Symbol
SOCS7
NCBI Official Synonym Symbols
NAP4; NCKAP4
NCBI Protein Information
suppressor of cytokine signaling 7
UniProt Protein Name
Suppressor of cytokine signaling 7
UniProt Gene Name
SOCS7
UniProt Synonym Gene Names
NAP4; SOCS6
UniProt Entry Name
SOCS7_HUMAN

Research Articles on SOCS7

Similar Products

Product Notes

The SOCS7 socs7 (Catalog #AAA3211455) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SOCS7 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SOCS7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SOCS7 socs7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GSAGRELDAG RKPKLTRTQS AFSPVSFSPL FTGETVSLVD VDISQRGLTS. It is sometimes possible for the material contained within the vial of "SOCS7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.