Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SNX4Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human SNX4 Polyclonal Antibody | anti-SNX4 antibody

SNX4 Antibody - middle region

Gene Names
SNX4; ATG24B
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SNX4; Polyclonal Antibody; SNX4 Antibody - middle region; anti-SNX4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TQEGNWKETVNETGFQLKADSRLKALNATFRVKNPDKRFTDLKHYSDELQ
Sequence Length
305
Applicable Applications for anti-SNX4 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SNX4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SNX4Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SNX4Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SNX4 antibody
This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein associated with the long isoform of the leptin receptor and with receptor tyrosine kinases for platelet-derived growth factor, insulin, and epidermal growth factor in cell cultures, but its function is unknown. This protein may form oligomeric complexes with family members. Two transcript variants, one protein coding and the other non-protein coding, have been found for this gene.
Product Categories/Family for anti-SNX4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33 kDa
NCBI Official Full Name
sorting nexin-4
NCBI Official Synonym Full Names
sorting nexin 4
NCBI Official Symbol
SNX4
NCBI Official Synonym Symbols
ATG24B
NCBI Protein Information
sorting nexin-4
UniProt Protein Name
Sorting nexin-4
Protein Family
UniProt Gene Name
SNX4
UniProt Entry Name
SNX4_HUMAN

NCBI Description

This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein associated with the long isoform of the leptin receptor and with receptor tyrosine kinases for platelet-derived growth factor, insulin, and epidermal growth factor in cell cultures, but its function is unknown. This protein may form oligomeric complexes with family members. Two transcript variants, one protein coding and the other non-protein coding, have been found for this gene. [provided by RefSeq, Nov 2012]

Uniprot Description

SNX4: May be involved in several stages of intracellular trafficking. Plays a role in recycling endocytosed transferrin receptor and prevent its degradation. Belongs to the sorting nexin family.

Chromosomal Location of Human Ortholog: 3q21.2

Cellular Component: SNARE complex; protein complex; extrinsic to membrane; membrane; cytoplasmic dynein complex; early endosome membrane; cytoplasm; plasma membrane

Molecular Function: protein binding; insulin receptor binding; phosphoinositide binding; epidermal growth factor receptor binding

Biological Process: protein transport; vesicle organization and biogenesis; endocytic recycling

Research Articles on SNX4

Similar Products

Product Notes

The SNX4 snx4 (Catalog #AAA3223443) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SNX4 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SNX4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SNX4 snx4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TQEGNWKETV NETGFQLKAD SRLKALNATF RVKNPDKRFT DLKHYSDELQ. It is sometimes possible for the material contained within the vial of "SNX4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.