Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using SNX25 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Rabbit anti-Human SNX25 Polyclonal Antibody | anti-SNX25 antibody
SNX25 Polyclonal Antibody
Gene Names
SNX25; SBBI31; MSTP043
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
SNX25; Polyclonal Antibody; SNX25 Polyclonal Antibody; MSTP043; SBBI31; anti-SNX25 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MKADLLRARNMKRYINQLTVAKKQCEKRIRILGGPAYDQQEDGALDEGEGPQSQKILQFEDILANTFYREHFGMYMERMDKRALISFWESVEHLKNANKNEIPQLVGEIYQNFFVESKEISVEKSLYKEIQQCLVGNKGIEVFYKIQEDVYETLKDRYYPSFIVSDLYEKLLIKEEEKHASQMISNKDEMGPRDEAGEEAVDDGTNQINEQASFAVNKLRELNEKLEYKRQALNSIQNAPKPDKKIVSKLKDEII
Sequence Length
840
Applicable Applications for anti-SNX25 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human SNX25
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Endosome membrane, Peripheral membrane protein
Positive Samples
HeLa, A-431
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using SNX25 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using SNX25 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Product Categories/Family for anti-SNX25 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 64kDa; 97kDa
Observed: 100kDa
Observed: 100kDa
NCBI Official Full Name
sorting nexin-25
NCBI Official Synonym Full Names
sorting nexin 25
NCBI Official Symbol
SNX25
NCBI Official Synonym Symbols
SBBI31; MSTP043
NCBI Protein Information
sorting nexin-25
UniProt Protein Name
Sorting nexin-25
Protein Family
UniProt Gene Name
SNX25
Uniprot Description
May be involved in several stages of intracellular trafficking.
Research Articles on SNX25
Similar Products
Product Notes
The SNX25 snx25 (Catalog #AAA9134327) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SNX25 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SNX25 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the SNX25 snx25 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MKADLLRARN MKRYINQLTV AKKQCEKRIR ILGGPAYDQQ EDGALDEGEG PQSQKILQFE DILANTFYRE HFGMYMERMD KRALISFWES VEHLKNANKN EIPQLVGEIY QNFFVESKEI SVEKSLYKEI QQCLVGNKGI EVFYKIQEDV YETLKDRYYP SFIVSDLYEK LLIKEEEKHA SQMISNKDEM GPRDEAGEEA VDDGTNQINE QASFAVNKLR ELNEKLEYKR QALNSIQNAP KPDKKIVSKL KDEII. It is sometimes possible for the material contained within the vial of "SNX25, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
