Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NHP2L1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysate)

Rabbit SNU13 Polyclonal Antibody | anti-SNU13 antibody

SNU13 Antibody - N-terminal region

Gene Names
SNU13; FA1; FA-1; NHPX; 15.5K; OTK27; SSFA1; NHP2L1; SPAG12; SNRNP15-5
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SNU13; Polyclonal Antibody; SNU13 Antibody - N-terminal region; anti-SNU13 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGI
Sequence Length
128
Applicable Applications for anti-SNU13 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NHP2L1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NHP2L1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysate)

Western Blot (WB) (WB Suggested Anti-NHP2L1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysate)
Related Product Information for anti-SNU13 antibody
This is a rabbit polyclonal antibody against NHP2L1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Originally named because of its sequence similarity to the Saccharomyces cerevisiae NHP2 (non-histone protein 2), this protein appears to be a highly conserved nuclear protein that is a component of the [U4/U6.U5] tri-snRNP. It binds to the 5' stem-loop of U4 snRNA. Two transcript variants encoding the same protein have been found for this gene.
Product Categories/Family for anti-SNU13 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14kDa
NCBI Official Full Name
NHP2-like protein 1
NCBI Official Synonym Full Names
small nuclear ribonucleoprotein 13
NCBI Official Symbol
SNU13
NCBI Official Synonym Symbols
FA1; FA-1; NHPX; 15.5K; OTK27; SSFA1; NHP2L1; SPAG12; SNRNP15-5
NCBI Protein Information
NHP2-like protein 1
UniProt Protein Name
NHP2-like protein 1
Protein Family
UniProt Gene Name
NHP2L1
UniProt Synonym Gene Names
hSNU13
UniProt Entry Name
NH2L1_HUMAN

NCBI Description

Originally named because of its sequence similarity to the Saccharomyces cerevisiae NHP2 (non-histone protein 2), this protein appears to be a highly conserved nuclear protein that is a component of the [U4/U6.U5] tri-snRNP. It binds to the 5' stem-loop of U4 snRNA. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

NHP2L1: Binds to the 5'-stem-loop of U4 snRNA and may play a role in the late stage of spliceosome assembly. The protein undergoes a conformational change upon RNA-binding. Belongs to the ribosomal protein L7Ae family.

Protein type: RNA splicing; Nucleolus; Spliceosome; RNA-binding

Chromosomal Location of Human Ortholog: 22q13

Cellular Component: nucleoplasm; spliceosome; protein complex; nucleolus; nucleus

Molecular Function: snoRNA binding; protein binding; RNA binding

Biological Process: nuclear mRNA splicing, via spliceosome; RNA splicing; ribosome biogenesis and assembly; gene expression

Research Articles on SNU13

Similar Products

Product Notes

The SNU13 nhp2l1 (Catalog #AAA3205092) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SNU13 Antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SNU13 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SNU13 nhp2l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MTEADVNPKA YPLADAHLTK KLLDLVQQSC NYKQLRKGAN EATKTLNRGI. It is sometimes possible for the material contained within the vial of "SNU13, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.