Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using SNRPD3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

Rabbit SNRPD3 Polyclonal Antibody | anti-SNRPD3 antibody

SNRPD3 Rabbit pAb

Gene Names
SNRPD3; SMD3; Sm-D3
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunofluorescence
Purity
Affinity purification
Synonyms
SNRPD3; Polyclonal Antibody; SNRPD3 Rabbit pAb; SMD3; Sm-D3; anti-SNRPD3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
KVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNI
Applicable Applications for anti-SNRPD3 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:2000
IF: 1:50-1:100
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 8-121 of human SNRPD3 (NP_001265585).
Cellular Location
Cytoplasm, Nucleus, cytosol
Positive Samples
HT-29, DU145, Mouse brain, Mouse liver, Rat pancreas
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using SNRPD3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using SNRPD3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-SNRPD3 antibody
Background: This gene encodes a core component of the spliceosome, which is a nuclear ribonucleoprotein complex that functions in pre-mRNA splicing. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13,292 Da
NCBI Official Full Name
small nuclear ribonucleoprotein Sm D3
NCBI Official Synonym Full Names
small nuclear ribonucleoprotein D3 polypeptide 18kDa
NCBI Official Symbol
SNRPD3
NCBI Official Synonym Symbols
SMD3; Sm-D3
NCBI Protein Information
small nuclear ribonucleoprotein Sm D3; snRNP core protein D3
UniProt Protein Name
Small nuclear ribonucleoprotein Sm D3
UniProt Gene Name
SNRPD3
UniProt Synonym Gene Names
Sm-D3
UniProt Entry Name
SMD3_HUMAN

NCBI Description

This gene encodes a core component of the spliceosome, which is a nuclear ribonucleoprotein complex that functions in pre-mRNA splicing. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]

Uniprot Description

snRNP D3: Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Binds to the downstream cleavage product (DCP) of histone pre-mRNA in a U7 snRNP dependent manner. Belongs to the snRNP core protein family.

Protein type: Spliceosome; RNA splicing; RNA-binding

Chromosomal Location of Human Ortholog: 22q11.23

Cellular Component: small nuclear ribonucleoprotein complex; nucleoplasm; spliceosome; cytoplasm; snRNP U1; cytosol; U12-dependent spliceosome

Molecular Function: protein binding; enzyme binding

Biological Process: transcription from RNA polymerase II promoter; nuclear mRNA splicing, via spliceosome; spliceosomal snRNP biogenesis; RNA splicing; histone mRNA metabolic process; gene expression; mRNA 3'-end processing; termination of RNA polymerase II transcription

Research Articles on SNRPD3

Similar Products

Product Notes

The SNRPD3 snrpd3 (Catalog #AAA9142168) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SNRPD3 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SNRPD3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). WB: 1:500-1:2000 IF: 1:50-1:100. Researchers should empirically determine the suitability of the SNRPD3 snrpd3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KVLHEAEGHI VTCETNTGEV YRGKLIEAED NMNCQMSNIT VTYRDGRVAQ LEQVYIRGSK IRFLILPDML KNAPMLKSMK NKNQGSGAGR GKAAILKAQV AARGRGRGMG RGNI. It is sometimes possible for the material contained within the vial of "SNRPD3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.