Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SNRPD2Sample Type: Human 293TAntibody Dilution: 1.0ug/mlSNRPD2 is supported by BioGPS gene expression data to be expressed in HEK293T)

Rabbit SNRPD2 Polyclonal Antibody | anti-SNRPD2 antibody

SNRPD2 antibody - N-terminal region

Gene Names
SNRPD2; SMD2; Sm-D2; SNRPD1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SNRPD2; Polyclonal Antibody; SNRPD2 antibody - N-terminal region; anti-SNRPD2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNK
Sequence Length
118
Applicable Applications for anti-SNRPD2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 77%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SNRPD2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SNRPD2Sample Type: Human 293TAntibody Dilution: 1.0ug/mlSNRPD2 is supported by BioGPS gene expression data to be expressed in HEK293T)

Western Blot (WB) (Host: RabbitTarget Name: SNRPD2Sample Type: Human 293TAntibody Dilution: 1.0ug/mlSNRPD2 is supported by BioGPS gene expression data to be expressed in HEK293T)

Western Blot (WB)

(Host: RabbitTarget Name: SNRPD2Sample Type: Human MCF7Antibody Dilution: 1.0ug/mlSNRPD2 is supported by BioGPS gene expression data to be expressed in MCF7)

Western Blot (WB) (Host: RabbitTarget Name: SNRPD2Sample Type: Human MCF7Antibody Dilution: 1.0ug/mlSNRPD2 is supported by BioGPS gene expression data to be expressed in MCF7)

Western Blot (WB)

(WB Suggested Anti-SNRPD2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateSNRPD2 is supported by BioGPS gene expression data to be expressed in Jurkat)

Western Blot (WB) (WB Suggested Anti-SNRPD2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateSNRPD2 is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-SNRPD2 antibody
This is a rabbit polyclonal antibody against SNRPD2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SNRPD2 belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis. Multiple transcript variants encoding different isoforms have been found for this gene.The protein encoded by this gene belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13kDa
NCBI Official Full Name
small nuclear ribonucleoprotein Sm D2 isoform 1
NCBI Official Synonym Full Names
small nuclear ribonucleoprotein D2 polypeptide
NCBI Official Symbol
SNRPD2
NCBI Official Synonym Symbols
SMD2; Sm-D2; SNRPD1
NCBI Protein Information
small nuclear ribonucleoprotein Sm D2
UniProt Protein Name
Small nuclear ribonucleoprotein Sm D2
UniProt Gene Name
SNRPD2
UniProt Synonym Gene Names
SNRPD1; Sm-D2
UniProt Entry Name
SMD2_HUMAN

NCBI Description

The protein encoded by this gene belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2009]

Uniprot Description

snRNP D2: Required for pre-mRNA splicing. Required for snRNP biogenesis. Belongs to the snRNP core protein family.

Protein type: RNA splicing; Spliceosome

Chromosomal Location of Human Ortholog: 19q13.2

Cellular Component: small nuclear ribonucleoprotein complex; nucleoplasm; spliceosome; snRNP U1; cytosol; U12-dependent spliceosome

Molecular Function: protein binding

Biological Process: nuclear mRNA splicing, via spliceosome; spliceosomal snRNP biogenesis; RNA splicing; spliceosome assembly; gene expression

Similar Products

Product Notes

The SNRPD2 snrpd2 (Catalog #AAA3205302) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SNRPD2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SNRPD2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SNRPD2 snrpd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSLLNKPKSE MTPEELQKRE EEEFNTGPLS VLTQSVKNNT QVLINCRNNK. It is sometimes possible for the material contained within the vial of "SNRPD2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.