Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SNAP23 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Rabbit SNAP23 Polyclonal Antibody | anti-SNAP23 antibody

SNAP23 antibody - N-terminal region

Gene Names
SNAP23; SNAP-23; SNAP23A; SNAP23B; HsT17016
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SNAP23; Polyclonal Antibody; SNAP23 antibody - N-terminal region; anti-SNAP23 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GIKTITMLDEQKEQLNRIEEGLDQINKDMRETEKTLTELNKCCGLCVCPC
Sequence Length
211
Applicable Applications for anti-SNAP23 antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 86%; Guinea Pig: 86%; Horse: 92%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86%; Yeast: 83%; Zebrafish: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SNAP23
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SNAP23 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-SNAP23 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
Related Product Information for anti-SNAP23 antibody
This is a rabbit polyclonal antibody against SNAP23. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SNAP23 is structurally and functionally similar to SNAP25 and binds tightly to multiple syntaxins and synaptobrevins/VAMPs. It is an essential component of the high affinity receptor for the general membrane fusion machinery and is an important regulator of transport vesicle docking and fusion. Two alternative transcript variants encoding different protein isoforms have been described for this gene.Specificity of vesicular transport is regulated, in part, by the interaction of a vesicle-associated membrane protein termed synaptobrevin/VAMP with a target compartment membrane protein termed syntaxin. These proteins, together with SNAP25 (synaptosome-associated protein of 25 kDa), form a complex which serves as a binding site for the general membrane fusion machinery. Synaptobrevin/VAMP and syntaxin are believed to be involved in vesicular transport in most, if not all cells, while SNAP25 is present almost exclusively in the brain, suggesting that a ubiquitously expressed homolog of SNAP25 exists to facilitate transport vesicle/target membrane fusion in other tissues. The protein encoded by this gene is structurally and functionally similar to SNAP25 and binds tightly to multiple syntaxins and synaptobrevins/VAMPs. It is an essential component of the high affinity receptor for the general membrane fusion machinery and is an important regulator of transport vesicle docking and fusion. Two alternative transcript variants encoding different protein isoforms have been described for this gene.
Product Categories/Family for anti-SNAP23 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
synaptosomal-associated protein 23 isoform SNAP23A
NCBI Official Synonym Full Names
synaptosome associated protein 23
NCBI Official Symbol
SNAP23
NCBI Official Synonym Symbols
SNAP-23; SNAP23A; SNAP23B; HsT17016
NCBI Protein Information
synaptosomal-associated protein 23
UniProt Protein Name
Synaptosomal-associated protein 23
UniProt Gene Name
SNAP23
UniProt Synonym Gene Names
SNAP-23
UniProt Entry Name
SNP23_HUMAN

NCBI Description

Specificity of vesicular transport is regulated, in part, by the interaction of a vesicle-associated membrane protein termed synaptobrevin/VAMP with a target compartment membrane protein termed syntaxin. These proteins, together with SNAP25 (synaptosome-associated protein of 25 kDa), form a complex which serves as a binding site for the general membrane fusion machinery. Synaptobrevin/VAMP and syntaxin are believed to be involved in vesicular transport in most, if not all cells, while SNAP25 is present almost exclusively in the brain, suggesting that a ubiquitously expressed homolog of SNAP25 exists to facilitate transport vesicle/target membrane fusion in other tissues. The protein encoded by this gene is structurally and functionally similar to SNAP25 and binds tightly to multiple syntaxins and synaptobrevins/VAMPs. It is an essential component of the high affinity receptor for the general membrane fusion machinery and is an important regulator of transport vesicle docking and fusion. Two alternative transcript variants encoding different protein isoforms have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

SNAP23: a member of the SNAP-25 family of SNARE proteins. Structurally and functionally similar to SNAP25 and binds tightly to multiple syntaxins and synaptobrevins/VAMPs. It is an essential component of the high affinity receptor for the general membrane fusion machinery and is an important regulator of transport vesicle docking and fusion. Two alternatively spliced isoforms have been described.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: 15q14

Cellular Component: nucleoplasm; SNARE complex; azurophil granule; specific granule; neuron projection; focal adhesion; mast cell granule; cytoplasm; plasma membrane; synapse

Molecular Function: SNAP receptor activity; protein binding; syntaxin binding

Biological Process: synaptic vesicle fusion to presynaptic membrane; protein transport; histamine secretion by mast cell; vesicle targeting; post-Golgi vesicle-mediated transport; synaptic vesicle priming

Research Articles on SNAP23

Similar Products

Product Notes

The SNAP23 snap23 (Catalog #AAA3209091) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SNAP23 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SNAP23 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SNAP23 snap23 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GIKTITMLDE QKEQLNRIEE GLDQINKDMR ETEKTLTELN KCCGLCVCPC. It is sometimes possible for the material contained within the vial of "SNAP23, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.