Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SMYD2Sample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human SMYD2 Polyclonal Antibody | anti-SMYD2 antibody

SMYD2 Antibody - middle region

Gene Names
SMYD2; KMT3C; HSKM-B; ZMYND14
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SMYD2; Polyclonal Antibody; SMYD2 Antibody - middle region; anti-SMYD2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKD
Sequence Length
272
Applicable Applications for anti-SMYD2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SMYD2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SMYD2Sample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SMYD2Sample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SMYD2 antibody
SET domain-containing proteins, such as SMYD2, catalyze lysine methylation.
Product Categories/Family for anti-SMYD2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31 kDa
NCBI Official Full Name
N-lysine methyltransferase SMYD2
NCBI Official Synonym Full Names
SET and MYND domain containing 2
NCBI Official Symbol
SMYD2
NCBI Official Synonym Symbols
KMT3C; HSKM-B; ZMYND14
NCBI Protein Information
N-lysine methyltransferase SMYD2
UniProt Protein Name
N-lysine methyltransferase SMYD2
UniProt Gene Name
SMYD2
UniProt Synonym Gene Names
KMT3C
UniProt Entry Name
SMYD2_HUMAN

NCBI Description

SET domain-containing proteins, such as SMYD2, catalyze lysine methylation (Brown et al., 2006 [PubMed 16805913]).[supplied by OMIM, Nov 2008]

Uniprot Description

SMYD2: Protein-lysine N-methyltransferase that methylates both histones and non-histone proteins. Specifically methylates histone H3 'Lys-4' (H3K4me) and dimethylates histone H3 'Lys-36' (H3K36me2). Has also methyltransferase activity toward non-histone proteins such as p53/TP53 and RB1. Monomethylates 'Lys-370' of p53/TP53, leading to decreased DNA-binding activity and subsequent transcriptional regulation activity of p53/TP53. Monomethylates 'Lys-860' of RB1/RB. Interacts with RNA polymerase II and HELZ. Interacts with SIN3A and HDAC1. Interacts (via MYND-type zinc finger) with EPB41L3. Interacts (via SET domain) with p53/TP53. Interacts with RB1 and HSP90AA1. Expression is repressed by CEBPA.

Protein type: Methyltransferase, protein lysine; EC 2.1.1.43; Methyltransferase

Chromosomal Location of Human Ortholog: 1q32.3

Cellular Component: nucleoplasm; cytoplasm; nucleus; cytosol

Molecular Function: protein binding; p53 binding; metal ion binding; protein-lysine N-methyltransferase activity; histone lysine N-methyltransferase activity (H3-K36 specific)

Biological Process: negative regulation of cell proliferation; establishment and/or maintenance of chromatin architecture; transcription, DNA-dependent; peptidyl-lysine di-methylation; peptidyl-lysine mono-methylation; histone H3-K36 methylation; negative regulation of transcription from RNA polymerase II promoter; regulation of DNA damage response, signal transduction by p53 class mediator

Research Articles on SMYD2

Similar Products

Product Notes

The SMYD2 smyd2 (Catalog #AAA3221790) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SMYD2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SMYD2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SMYD2 smyd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AEVRAVQEIK PGEEVFTSYI DLLYPTEDRN DRLRDSYFFT CECQECTTKD. It is sometimes possible for the material contained within the vial of "SMYD2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.