Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of SMURF2 expression in SMMC whole cell lysates (lane 1). SMURF2 at 86KD was detected using rabbit anti- SMURF2 Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.)

anti-Human SMURF 2 Polyclonal Antibody | anti-SMURF 2 antibody

Anti-SMURF 2 Antibody

Reactivity
Human
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
SMURF 2; Polyclonal Antibody; Anti-SMURF 2 Antibody; E3 ubiquitin-protein ligase SMURF2; EC 6.3.2.; hSMURF2; MGC138150; Smad specific E3 ubiquitin ligase 2; SMAD specific E3 ubiquitin protein ligase 2; SMAD ubiquitination regulatory factor 2; SMAD-specific E3 ubiquitin-protein ligase 2; SMUF2_HUMAN; Smurf2; Ubiquitin protein ligase SMURF2; anti-SMURF 2 antibody
Ordering
For Research Use Only!
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
748
Applicable Applications for anti-SMURF 2 antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human SMURF 2 (317-351aa DHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQQ), identical to the related mouse sequence.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of SMURF2 expression in SMMC whole cell lysates (lane 1). SMURF2 at 86KD was detected using rabbit anti- SMURF2 Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.)

Western Blot (WB) (Western blot analysis of SMURF2 expression in SMMC whole cell lysates (lane 1). SMURF2 at 86KD was detected using rabbit anti- SMURF2 Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.)
Related Product Information for anti-SMURF 2 antibody
Description: Rabbit IgG polyclonal antibody for E3 ubiquitin-protein ligase SMURF2(SMURF2) detection. Tested with WB in Human.

Background: E3 ubiquitin-protein ligase SMURF2 is an enzyme that in humans is encoded by the SMURF2 gene. The SMURF2 gene is mapped to chromosome 17q22-q23 based on sequence similarity between the SMURF2 sequence and a genomic contig. SMURF2 is a HECT domain E3 ubiquitin ligase involved in degradation of SMADs, TGF-beta receptor (TGFBR), and other substrates. It also functions in regulation of neuronal and planar cell polarity, induction of senescence, and tumor suppression
References
1. "Entrez Gene: SMURF2 SMAD specific E3 ubiquitin protein ligase 2". 2. Blank, M., Tang, Y., Yamashita, M., Burkett, S. S., Cheng, S. Y., Zhang, Y. E. A tumor suppressor function of Smurf2 associated with controlling chromatin landscape and genome stability through RNF20. Nature Med. 18: 227-234, 2012. 3. Lin X, Liang M, Feng XH (Nov 2000). "Smurf2 is a ubiquitin E3 ligase mediating proteasome-dependent degradation of Smad2 in transforming growth factor-beta signaling". The Journal of Biological Chemistry 275(47): 36818-22.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86,196 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase SMURF2
NCBI Official Synonym Full Names
SMAD specific E3 ubiquitin protein ligase 2
NCBI Official Symbol
SMURF2
NCBI Protein Information
E3 ubiquitin-protein ligase SMURF2
UniProt Protein Name
E3 ubiquitin-protein ligase SMURF2
UniProt Gene Name
SMURF2
UniProt Synonym Gene Names
hSMURF2
UniProt Entry Name
SMUF2_HUMAN

Uniprot Description

SMURF2: E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Interacts with SMAD1 and SMAD7 in order to trigger their ubiquitination and proteasome-dependent degradation. In addition, interaction with SMAD7 activates autocatalytic degradation, which is prevented by interaction with SCYE1. Forms a stable complex with the TGF-beta receptor-mediated phosphorylated SMAD2 and SMAD3. In this way, SMAD2 may recruit substrates, such as SNON, for ubiquitin-mediated degradation. Enhances the inhibitory activity of SMAD7 and reduces the transcriptional activity of SMAD2. Coexpression of SMURF2 with SMAD1 results in considerable decrease in steady-state level of SMAD1 protein and a smaller decrease of SMAD2 level.

Protein type: EC 6.3.2.19; Ubiquitin ligase; Ligase; Ubiquitin conjugating system; EC 6.3.2.-

Chromosomal Location of Human Ortholog: 17q22-q23

Cellular Component: cytoplasm; cytosol; lipid raft; nucleoplasm; nucleus; plasma membrane; ubiquitin ligase complex

Molecular Function: identical protein binding; ligase activity; protein binding; SMAD binding; transforming growth factor beta receptor binding; ubiquitin-protein ligase activity

Biological Process: BMP signaling pathway; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; negative regulation of transforming growth factor beta receptor signaling pathway; protein polyubiquitination; protein ubiquitination during ubiquitin-dependent protein catabolic process; regulation of transforming growth factor beta receptor signaling pathway; ubiquitin-dependent protein catabolic process; ubiquitin-dependent SMAD protein catabolic process; Wnt receptor signaling pathway, planar cell polarity pathway

Research Articles on SMURF 2

Similar Products

Product Notes

The SMURF 2 smurf2 (Catalog #AAA178265) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-SMURF 2 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SMURF 2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the SMURF 2 smurf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SMURF 2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.