Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SMAP1 polyclonal antibody. Western Blot analysis of SMAP1 expression in HeLa.)

Mouse anti-Human SMAP1 Polyclonal Antibody | anti-SMAP1 antibody

SMAP1 (Smooth Muscle Cell-associated Protein 1, SMAP-1, Protein Unc-45 Homolog A, UNC45A, Unc-45A, GCUNC-45)

Gene Names
SMAP1; SMAP-1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
SMAP1; Polyclonal Antibody; SMAP1 (Smooth Muscle Cell-associated Protein 1; SMAP-1; Protein Unc-45 Homolog A; UNC45A; Unc-45A; GCUNC-45); Anti -SMAP1 (Smooth Muscle Cell-associated Protein 1; anti-SMAP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SMAP1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTAEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIRDKYEKKKYYDKNAIAITNKEKEKKKEEKKREKEPEKPAKPLTAEKLQKKDQQLEPKKSTSPKKAAEPTVDLLGLDGPAVAPVTNGNTTVPPLNDDLDIFGPMISNPLPATVMPPAQGTPSAPAAATLSTVTSGDLDLFTEQTTKSEEVAKKQLSKDSILSLYGTGTIQQQSTPGVFMGPTNIPFTSQAPAAFQGFPSMGVPVPAAPGLIGNVMGQSPSMMVGMPMPNGFMGNAQTGVMPLPQNVVGPQGGMVGQMGAPQSKFGLPQAQQPQWSLSQMNQQMAGMSISSATPTAGFGQPSSTTAGWSGSSSGQTLSTQLWK
Applicable Applications for anti-SMAP1 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human SMAP1, aa1-440 (NP_068759.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(SMAP1 polyclonal antibody. Western Blot analysis of SMAP1 expression in HeLa.)

Western Blot (WB) (SMAP1 polyclonal antibody. Western Blot analysis of SMAP1 expression in HeLa.)

Western Blot (WB)

(SMAP1 polyclonal antibody. Western Blot analysis of SMAP1 expression in K-562.)

Western Blot (WB) (SMAP1 polyclonal antibody. Western Blot analysis of SMAP1 expression in K-562.)

Western Blot (WB)

(Western Blot analysis of SMAP1 expression in transfected 293T cell line by SMAP1 polyclonal antibody. Lane 1: SMAP1 transfected lysate (48.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SMAP1 expression in transfected 293T cell line by SMAP1 polyclonal antibody. Lane 1: SMAP1 transfected lysate (48.4kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-SMAP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,386 Da
NCBI Official Full Name
stromal membrane-associated protein 1 isoform D
NCBI Official Synonym Full Names
small ArfGAP 1
NCBI Official Symbol
SMAP1
NCBI Official Synonym Symbols
SMAP-1
NCBI Protein Information
stromal membrane-associated protein 1; stromal membrane-associated GTPase-activating protein 1
UniProt Protein Name
Stromal membrane-associated protein 1
Protein Family
UniProt Gene Name
SMAP1
UniProt Entry Name
SMAP1_HUMAN

NCBI Description

The protein encoded by this gene is similar to the mouse stromal membrane-associated protein-1. This similarity suggests that this human gene product is also a type II membrane glycoprotein involved in the erythropoietic stimulatory activity of stromal cells. Alternate splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

SMAP1: GTPase activating protein that acts on ARF6. Plays a role in clathrin-dependent endocytosis. May play a role in erythropoiesis. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: GAPs; GAPs, ARF; Cell development/differentiation

Chromosomal Location of Human Ortholog: 6q13

Cellular Component: cytoplasm; plasma membrane

Molecular Function: clathrin binding; zinc ion binding

Biological Process: positive regulation of erythrocyte differentiation; positive regulation of GTPase activity

Research Articles on SMAP1

Similar Products

Product Notes

The SMAP1 smap1 (Catalog #AAA6007570) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SMAP1 (Smooth Muscle Cell-associated Protein 1, SMAP-1, Protein Unc-45 Homolog A, UNC45A, Unc-45A, GCUNC-45) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SMAP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the SMAP1 smap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MATRSCREKA QKLNEQHQLI LSKLLREEDN KYCADCEAKG PRWASWNIGV FICIRCAGIH RNLGVHISRV KSVNLDQWTA EQIQCMQDMG NTKARLLYEA NLPENFRRPQ TDQAVEFFIR DKYEKKKYYD KNAIAITNKE KEKKKEEKKR EKEPEKPAKP LTAEKLQKKD QQLEPKKSTS PKKAAEPTVD LLGLDGPAVA PVTNGNTTVP PLNDDLDIFG PMISNPLPAT VMPPAQGTPS APAAATLSTV TSGDLDLFTE QTTKSEEVAK KQLSKDSILS LYGTGTIQQQ STPGVFMGPT NIPFTSQAPA AFQGFPSMGV PVPAAPGLIG NVMGQSPSMM VGMPMPNGFM GNAQTGVMPL PQNVVGPQGG MVGQMGAPQS KFGLPQAQQP QWSLSQMNQQ MAGMSISSAT PTAGFGQPSS TTAGWSGSSS GQTLSTQLWK. It is sometimes possible for the material contained within the vial of "SMAP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.