Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of SLC6A17 expression in transfected 293T cell line by SLC6A17 polyclonal antibody. Lane 1: SLC6A17 transfected lysate (81kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human SLC6A17 Polyclonal Antibody | anti-SLC6A17 antibody

SLC6A17 (Solute Carrier Family 6 Member 17, Sodium-dependent Neutral Amino Acid Transporter SLC6A17, Sodium-dependent Neurotransmitter Transporter NTT4, NTT4)

Gene Names
SLC6A17; NTT4
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
SLC6A17; Polyclonal Antibody; SLC6A17 (Solute Carrier Family 6 Member 17; Sodium-dependent Neutral Amino Acid Transporter SLC6A17; Sodium-dependent Neurotransmitter Transporter NTT4; NTT4); Anti -SLC6A17 (Solute Carrier Family 6 Member 17; anti-SLC6A17 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SLC6A17.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MPKNSKVTQREHSSEHVTESVADLLALEEPVDYKQSVLNVAGEAGGKQKAVEEELDAEDRPAWNSKLQYILAQIGFSVGLGNIWRFPYLCQKNGGGAYLVPYLVLLIIIGIPLFFLELAVGQRIRRGSIGVWHYICPRLGGIGFSSCIVCLFVGLYYNVIIGWSIFYFFKSFQYPLPWSECPVVRNGSVAVVEAECEKSSATTYFWYREALDISDSISESGGLNWKMTLCLLVAWSIVGMAVVKGIQSSGKVMYFSSLFPYVVLACFLVRGLLLRGAVDGILHMFTPKLDKMLDPQVWREAATQVFFALGLGFGGVIAFSSYNKQDNNCHFDAALVSFINFFTSVLATLVVFAVLGFKANIMNEKCVVENAEKILGYLNTNVLSRDLIPPHVNFSHLTTKDYMEMYNVIMTVKEDQFSALGLDPCLLEDELDKSVQGTGLAFIAFTEAMTHFPASPFWSVMFFLMLINLGLGSMIGTMAGITTPIIDTFKVPKEMFTVGCCVFAFLVGLLFVQRSGNYFVTMFDDYSATLPLTLIVILENIAVAWIYGTKKFMQELTEMLGFRPYRFYFYMWKFVSPLCMAVLTTASIIQLGVTPPGYSAWIKEEAAERYLYFPNWAMALLITLIVVATLPIPVVFVLRHFHLLSDGSNTLSVSYKKGRMMKDISNLEENDETRFILSKVPSEAPSPMPTHRSYLGPGSTSPLETSGNPNGRYGSGYLLASTPESEL
Applicable Applications for anti-SLC6A17 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human SLC6A17, aa1-727 (NP_001010898.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SLC6A17 expression in transfected 293T cell line by SLC6A17 polyclonal antibody. Lane 1: SLC6A17 transfected lysate (81kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SLC6A17 expression in transfected 293T cell line by SLC6A17 polyclonal antibody. Lane 1: SLC6A17 transfected lysate (81kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-SLC6A17 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
81,001 Da
NCBI Official Full Name
sodium-dependent neutral amino acid transporter SLC6A17
NCBI Official Synonym Full Names
solute carrier family 6 (neutral amino acid transporter), member 17
NCBI Official Symbol
SLC6A17
NCBI Official Synonym Symbols
NTT4
NCBI Protein Information
sodium-dependent neutral amino acid transporter SLC6A17; solute carrier family 6, member 17; sodium-dependent neurotransmitter transporter NTT4; solute carrier family 6 (neurotransmitter transporter), member 17; orphan sodium- and chloride-dependent neurotransmitter transporter NTT4
UniProt Protein Name
Sodium-dependent neutral amino acid transporter SLC6A17
UniProt Gene Name
SLC6A17
UniProt Synonym Gene Names
NTT4
UniProt Entry Name
S6A17_HUMAN

NCBI Description

The SLC6 family of proteins, which includes SLC6A17, acts as specific transporters for neurotransmitters, amino acids, and osmolytes like betaine, taurine, and creatine. SLC6 proteins are sodium cotransporters that derive the energy for solute transport from the electrochemical gradient for sodium ions (Hoglund et al., 2005 [PubMed 16125675]).[supplied by OMIM, Mar 2008]

Uniprot Description

SLC6A17: Functions as a sodium-dependent vesicular transporter selective for proline, glycine, leucine and alanine. In contrast to other members of this neurotransmitter transporter family, does not appear to be chloride-dependent. Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A17 subfamily.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 1p13.3

Cellular Component: synaptic vesicle; synaptic vesicle membrane; integral to plasma membrane; cell junction

Molecular Function: neurotransmitter:sodium symporter activity

Biological Process: neutral amino acid transport; leucine transport; glycine transport; alanine transport; neurotransmitter transport; proline transport; transmembrane transport

Disease: Mental Retardation, Autosomal Recessive 48

Research Articles on SLC6A17

Similar Products

Product Notes

The SLC6A17 slc6a17 (Catalog #AAA642292) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC6A17 (Solute Carrier Family 6 Member 17, Sodium-dependent Neutral Amino Acid Transporter SLC6A17, Sodium-dependent Neurotransmitter Transporter NTT4, NTT4) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC6A17 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the SLC6A17 slc6a17 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPKNSKVTQR EHSSEHVTES VADLLALEEP VDYKQSVLNV AGEAGGKQKA VEEELDAEDR PAWNSKLQYI LAQIGFSVGL GNIWRFPYLC QKNGGGAYLV PYLVLLIIIG IPLFFLELAV GQRIRRGSIG VWHYICPRLG GIGFSSCIVC LFVGLYYNVI IGWSIFYFFK SFQYPLPWSE CPVVRNGSVA VVEAECEKSS ATTYFWYREA LDISDSISES GGLNWKMTLC LLVAWSIVGM AVVKGIQSSG KVMYFSSLFP YVVLACFLVR GLLLRGAVDG ILHMFTPKLD KMLDPQVWRE AATQVFFALG LGFGGVIAFS SYNKQDNNCH FDAALVSFIN FFTSVLATLV VFAVLGFKAN IMNEKCVVEN AEKILGYLNT NVLSRDLIPP HVNFSHLTTK DYMEMYNVIM TVKEDQFSAL GLDPCLLEDE LDKSVQGTGL AFIAFTEAMT HFPASPFWSV MFFLMLINLG LGSMIGTMAG ITTPIIDTFK VPKEMFTVGC CVFAFLVGLL FVQRSGNYFV TMFDDYSATL PLTLIVILEN IAVAWIYGTK KFMQELTEML GFRPYRFYFY MWKFVSPLCM AVLTTASIIQ LGVTPPGYSA WIKEEAAERY LYFPNWAMAL LITLIVVATL PIPVVFVLRH FHLLSDGSNT LSVSYKKGRM MKDISNLEEN DETRFILSKV PSEAPSPMPT HRSYLGPGST SPLETSGNPN GRYGSGYLLA STPESEL. It is sometimes possible for the material contained within the vial of "SLC6A17, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.