Western Blot (WB)
(Figure 1. Western blot analysis of SLC6A1 using anti-SLC6A1 antibody (MBS1750893).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat brain tissue lysate,Lane 2: mouse brain tissue lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SLC6A1 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for SLC6A1 at approximately 88KD. The expected band size for SLC6A1 is at 67KD. )
Rabbit SLC6A1/Gat 1 Polyclonal Antibody | anti-SLC6A1/Gat 1 antibody
Anti-SLC6A1/Gat 1 Antibody
Gene Names
SLC6A1; MAE; GAT1; GABATR; GABATHG
Reactivity
Human, Mouse, RatNo cross reactivity with other proteins.
Applications
Western Blot
Purity
Immunogen affinity purified
Synonyms
SLC6A1/Gat 1; Polyclonal Antibody; Anti-SLC6A1/Gat 1 Antibody; Sodium- and chloride-dependent GABA transporter 1; GAT-1; Solute carrier family 6 member 1; SLC6A1; GABATR; GABT1; GAT1; anti-SLC6A1/Gat 1 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
No cross reactivity with other proteins.
Clonality
Polyclonal
Purity/Purification
Immunogen affinity purified
Form/Format
Lyophilized
Concentration
Add 0.2ml of distilled water will yield a concentration of 500ug/ml. (varies by lot)
Sequence Length
599
Applicable Applications for anti-SLC6A1/Gat 1 antibody
Western Blot (WB)
Application Notes
WB: 0.1-0.5mug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human SLC6A1 (23-54aa ANDKPKTLVVKVQKKAADLPDRDTWKGRFDFL), different from the related mouse and rat sequences by two amino acids.
Subcellular Localization
Cell membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein. Localized at the plasma membrane and in a subset of intracellular vesicles. Localized at the presynaptic terminals of interneurons (By similarity).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Western Blot (WB)
(Figure 1. Western blot analysis of SLC6A1 using anti-SLC6A1 antibody (MBS1750893). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat brain tissue lysate,Lane 2: mouse brain tissue lysate. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SLC6A1 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for SLC6A1 at approximately 88KD. The expected band size for SLC6A1 is at 67KD. )
Western Blot (WB)
(Figure 1. Western blot analysis of SLC6A1 using anti-SLC6A1 antibody (MBS1750893).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat brain tissue lysate,Lane 2: mouse brain tissue lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SLC6A1 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for SLC6A1 at approximately 88KD. The expected band size for SLC6A1 is at 67KD. )
Related Product Information for anti-SLC6A1/Gat 1 antibody
Description: GABA transporter 1 (GAT1), also known as sodium- and chloride-dependent GABA transporter 1, is a protein that in humans is encoded by the SLC6A1 gene. GABA Transporter 1 uses Na+ and Cl- to create a gradient, which removes or adds GABA to extracellular spaces in the cerebrum and cerebellum. The stoichiometry for GABA Transporter 1 is 2 Na+: 1 Cl-: 1 GABA. The activity of GAT1 is largely dependent on the presence of Na+, while Cl- assists by increasing the ability for GAT-1 to uptake GABA.
Protein Function: Terminates the action of GABA by its high affinity sodium-dependent reuptake into presynaptic terminals.
Protein Function: Terminates the action of GABA by its high affinity sodium-dependent reuptake into presynaptic terminals.
Product Categories/Family for anti-SLC6A1/Gat 1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
67074 MW
NCBI Official Full Name
sodium- and chloride-dependent GABA transporter 1 isoform a
NCBI Official Synonym Full Names
solute carrier family 6 member 1
NCBI Official Symbol
SLC6A1
NCBI Official Synonym Symbols
MAE; GAT1; GABATR; GABATHG
NCBI Protein Information
sodium- and chloride-dependent GABA transporter 1
UniProt Protein Name
Sodium- and chloride-dependent GABA transporter 1
UniProt Gene Name
SLC6A1
UniProt Synonym Gene Names
GABATR; GABT1; GAT1; GAT-1
NCBI Description
The protein encoded by this gene is a gamma-aminobutyric acid (GABA) transporter that localizes to the plasma membrane. The encoded protein removes GABA from the synaptic cleft, restoring it to presynaptic terminals. [provided by RefSeq, Jan 2017]
Uniprot Description
Terminates the action of GABA by its high affinity sodium-dependent reuptake into presynaptic terminals.
Research Articles on SLC6A1/Gat 1
Similar Products
Product Notes
The SLC6A1/Gat 1 slc6a1 (Catalog #AAA1750893) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-SLC6A1/Gat 1 Antibody reacts with Human, Mouse, Rat No cross reactivity with other proteins. and may cross-react with other species as described in the data sheet. AAA Biotech's SLC6A1/Gat 1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 0.1-0.5mug/ml. Researchers should empirically determine the suitability of the SLC6A1/Gat 1 slc6a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC6A1/Gat 1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
