Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded human liver using SLC5A6 antibody at dilution of 1:100 (40x lens).)

Rabbit SLC5A6 Polyclonal Antibody | anti-SLC5A6 antibody

SLC5A6 Polyclonal Antibody

Gene Names
SLC5A6; SMVT
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry
Purity
Affinity Purification
Synonyms
SLC5A6; Polyclonal Antibody; SLC5A6 Polyclonal Antibody; SMVT; anti-SLC5A6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
TVATVTTLMPLTTFSKPTGLQRFYSLSYLWYSAHNSTTVIVVGLIVSLLTGRMRGRSLNPATIYPVLPKLLSLLPLSCQKRLHCRSYGQDHLDTGLFPEKPRNGVLGDSRDKEAMALDGTAYQGSSSTCILQETSL
Sequence Length
635
Applicable Applications for anti-SLC5A6 antibody
Immunohistochemistry (IHC)
Application Notes
IHC: 1:50 - 1:200
Immunogen
A synthetic peptide of human SLC5A6
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Membrane, Multi-pass membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded human liver using SLC5A6 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded human liver using SLC5A6 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded rat heart using SLC5A6 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded rat heart using SLC5A6 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded mouse heart using SLC5A6 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded mouse heart using SLC5A6 antibody at dilution of 1:100 (40x lens).)
Product Categories/Family for anti-SLC5A6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68kDa
NCBI Official Full Name
sodium-dependent multivitamin transporter
NCBI Official Synonym Full Names
solute carrier family 5 member 6
NCBI Official Symbol
SLC5A6
NCBI Official Synonym Symbols
SMVT
NCBI Protein Information
sodium-dependent multivitamin transporter
UniProt Protein Name
Sodium-dependent multivitamin transporter
UniProt Gene Name
SLC5A6
UniProt Synonym Gene Names
SMVT; Na(+)-dependent multivitamin transporter

Uniprot Description

Transports pantothenate, biotin and lipoate in the presence of sodium.

Research Articles on SLC5A6

Similar Products

Product Notes

The SLC5A6 slc5a6 (Catalog #AAA9134806) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC5A6 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC5A6 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC). IHC: 1:50 - 1:200. Researchers should empirically determine the suitability of the SLC5A6 slc5a6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TVATVTTLMP LTTFSKPTGL QRFYSLSYLW YSAHNSTTVI VVGLIVSLLT GRMRGRSLNP ATIYPVLPKL LSLLPLSCQK RLHCRSYGQD HLDTGLFPEK PRNGVLGDSR DKEAMALDGT AYQGSSSTCI LQETSL. It is sometimes possible for the material contained within the vial of "SLC5A6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.