Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SLC4A5 Antibody Titration: 0.2-1 ug/mlPositive Control: THP-1 cell lysate)

Rabbit SLC4A5 Polyclonal Antibody | anti-SLC4A5 antibody

SLC4A5 antibody - middle region

Gene Names
SLC4A5; NBC4; NBCe2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC4A5; Polyclonal Antibody; SLC4A5 antibody - middle region; anti-SLC4A5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SIAHIDSLKMETETSAPGEQPQFLGVREQRVTGIIVFILTGISVFLAPIL
Sequence Length
1137
Applicable Applications for anti-SLC4A5 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SLC4A5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SLC4A5 Antibody Titration: 0.2-1 ug/mlPositive Control: THP-1 cell lysate)

Western Blot (WB) (WB Suggested Anti-SLC4A5 Antibody Titration: 0.2-1 ug/mlPositive Control: THP-1 cell lysate)
Related Product Information for anti-SLC4A5 antibody
This is a rabbit polyclonal antibody against SLC4A5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a member of the sodium bicarbonate cotransporter (NBC) family, part of the bicarbonate transporter superfamily. Sodium bicarbonate cotransporters are involved in intracellular pH regulation and electroneural or electrogenic sodium bicarb
Product Categories/Family for anti-SLC4A5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
126kDa
NCBI Official Full Name
electrogenic sodium bicarbonate cotransporter 4 isoform a
NCBI Official Synonym Full Names
solute carrier family 4 member 5
NCBI Official Symbol
SLC4A5
NCBI Official Synonym Symbols
NBC4; NBCe2
NCBI Protein Information
electrogenic sodium bicarbonate cotransporter 4
UniProt Protein Name
Electrogenic sodium bicarbonate cotransporter 4
UniProt Gene Name
SLC4A5

NCBI Description

This gene encodes a member of the sodium bicarbonate cotransporter (NBC) family, part of the bicarbonate transporter superfamily. Sodium bicarbonate cotransporters are involved in intracellular pH regulation and electroneural or electrogenic sodium bicarbonate transport. This protein is thought to be an integral membrane protein. Multiple transcript variants encoding different isoforms have been found for this gene, but the biological validity of some variants has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

Mediates sodium- and bicarbonate-dependent electrogenic sodium bicarbonate cotransport, with a Na+:HCO3- stoichiometry of 2:1. May have a housekeeping function in regulating the pH of tissues in which it is expressed. May play a role in mediating Na+:HCO3- cotransport in hepatocytes and intrahepatic cholangiocytes. Also may be important in protecting the renal paranchyma from alterations in urine pH.

Research Articles on SLC4A5

Similar Products

Product Notes

The SLC4A5 slc4a5 (Catalog #AAA3207163) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC4A5 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SLC4A5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC4A5 slc4a5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SIAHIDSLKM ETETSAPGEQ PQFLGVREQR VTGIIVFILT GISVFLAPIL. It is sometimes possible for the material contained within the vial of "SLC4A5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.