Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-SLC4A11 Polyclonal Antibody)

Rabbit anti-Human, Mouse SLC4A11 Polyclonal Antibody | anti-SLC4A11 antibody

SLC4A11 Polyclonal Antibody

Gene Names
SLC4A11; BTR1; CHED; CDPD1; CHED2; NABC1; dJ794I6.2
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
SLC4A11; Polyclonal Antibody; SLC4A11 Polyclonal Antibody; BTR1; CDPD1; CHED; CHED2; NABC1; dJ794I6.2; solute carrier family 4 member 11; anti-SLC4A11 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.59 mg/ml (varies by lot)
Sequence Length
875
Applicable Applications for anti-SLC4A11 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human SLC4A11 (NP_114423.1).
Immunogen Sequence
MSQVGGRGDRCTQEVQGLVHGAGDLSASLAENSPTMSQNGYFEDSSYYKCDTDDTFEAREEILGDEAFDTANSSIVSGESIRFFVNVNLEMQATNTENEATSGGCVLLHTSRKYLKLKNFKEEIRAHRDLDGFLAQASIVLNETATSLDNVLRTMLRRFARDPDNNEPNCNLDLLMAMLF
Positive Samples
293T, Mouse Kidney
Cellular Location
Cell Membrane, Membrane, Multi-Pass Membrane Protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-SLC4A11 Polyclonal Antibody)

Western Blot (WB) (Western blot-SLC4A11 Polyclonal Antibody)
Related Product Information for anti-SLC4A11 antibody
This gene encodes a voltage-regulated, electrogenic sodium-coupled borate cotransporter that is essential for borate homeostasis, cell growth and cell proliferation. Mutations in this gene have been associated with a number of endothelial corneal dystrophies including recessive corneal endothelial dystrophy 2, corneal dystrophy and perceptive deafness, and Fuchs endothelial corneal dystrophy. Multiple transcript variants encoding different isoforms have been described.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 45kDa; 98kDa; 99kDa; 103kDa
Observed: 100kDa; 110kDa
NCBI Official Full Name
sodium bicarbonate transporter-like protein 11 isoform 3
NCBI Official Synonym Full Names
solute carrier family 4 member 11
NCBI Official Symbol
SLC4A11
NCBI Official Synonym Symbols
BTR1; CHED; CDPD1; CHED2; NABC1; dJ794I6.2
NCBI Protein Information
sodium bicarbonate transporter-like protein 11
UniProt Protein Name
Sodium bicarbonate transporter-like protein 11
UniProt Gene Name
SLC4A11
UniProt Synonym Gene Names
BTR1; NaBC1
UniProt Entry Name
S4A11_HUMAN

NCBI Description

This gene encodes a voltage-regulated, electrogenic sodium-coupled borate cotransporter that is essential for borate homeostasis, cell growth and cell proliferation. Mutations in this gene have been associated with a number of endothelial corneal dystrophies including recessive corneal endothelial dystrophy 2, corneal dystrophy and perceptive deafness, and Fuchs endothelial corneal dystrophy. Multiple transcript variants encoding different isoforms have been described. [provided by RefSeq, Mar 2010]

Uniprot Description

SLC4A11: Transporter which plays an important role in sodium- mediated fluid transport in different organs. Prevents severe morphological changes of the cornea caused by increased sodium chloride concentrations in the stroma. In the inner ear, is involved in transport of potassium through the fibrocyte layer to the stria vascularis and is essential for the generation of the endocochlear potential but not for regulation of potassium concentrations in the endolymph. In the kidney, is essential for urinary concentration, mediates a sodium flux into the thin descending limb of Henle loop to allow countercurrent multiplication by osmotic equilibration. Involved in borate homeostasis. In the absence of borate, it functions as a Na(+) and OH(-)(H(+)) channel. In the presence of borate functions as an electrogenic Na(+) coupled borate cotransporter. Defects in SLC4A11 are the cause of corneal dystrophy and perceptive deafness (CDPD); also known as corneal dystrophy and sensorineural deafness or Harboyan syndrome. CDPD consists of congenital corneal endothelial dystrophy and progressive perceptive deafness. Inheritance is autosomal recessive. Defects in SLC4A11 are the cause of corneal endothelial dystrophy type 2 (CHED2); also known as congenital hereditary endothelial dystrophy of cornea. This bilateral corneal dystrophy is characterized by corneal opacification and nystagmus. Inheritance is autosomal recessive. Defects in SLC4A11 are the cause of corneal dystrophy Fuchs endothelial type 4 (FECD4); also known as Corneal dystrophy Fuchs endothelial late-onset. It is an ocular disorder caused by loss of endothelium of the central cornea. It is characterized by focal wart-like guttata that arise from Descemet membrane and develop in the central cornea, epithelial blisters, reduced vision and pain. Descemet membrane is thickened by abnormal collagenous deposition. Belongs to the anion exchanger (TC 2.A.31) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 20p12

Cellular Component: integral to plasma membrane; basolateral plasma membrane

Molecular Function: protein dimerization activity; bicarbonate transmembrane transporter activity; inorganic anion exchanger activity; symporter activity; boron transporter activity; hydrogen ion channel activity; sodium channel activity

Biological Process: proton transport; cellular cation homeostasis; fluid transport; bicarbonate transport; sodium ion transport; regulation of intracellular pH; boron transport

Disease: Corneal Dystrophy And Perceptive Deafness; Corneal Dystrophy, Fuchs Endothelial, 4; Corneal Endothelial Dystrophy 2, Autosomal Recessive

Research Articles on SLC4A11

Similar Products

Product Notes

The SLC4A11 slc4a11 (Catalog #AAA9140605) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC4A11 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SLC4A11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the SLC4A11 slc4a11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC4A11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.