Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SLC3A1Sample Tissue: Human PANC1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human SLC3A1 Polyclonal Antibody | anti-SLC3A1 antibody

SLC3A1 Antibody - middle region

Gene Names
SLC3A1; D2H; ATR1; NBAT; RBAT; CSNU1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SLC3A1; Polyclonal Antibody; SLC3A1 Antibody - middle region; anti-SLC3A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NIVAANLNESYDINTLRSKSPMQWDNSSNAGFSEASNTWLPTNSDYHTVN
Sequence Length
316
Applicable Applications for anti-SLC3A1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SLC3A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SLC3A1Sample Tissue: Human PANC1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SLC3A1Sample Tissue: Human PANC1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SLC3A1 antibody
This gene encodes a type II membrane glycoprotein which is one of the components of the renal amino acid transporter which transports neutral and basic amino acids in the renal tubule and intestinal tract. Mutations and deletions in this gene are associated with cystinuria. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34 kDa
NCBI Official Full Name
neutral and basic amino acid transport protein rBAT
NCBI Official Synonym Full Names
solute carrier family 3 member 1
NCBI Official Symbol
SLC3A1
NCBI Official Synonym Symbols
D2H; ATR1; NBAT; RBAT; CSNU1
NCBI Protein Information
neutral and basic amino acid transport protein rBAT
UniProt Protein Name
Neutral and basic amino acid transport protein rBAT
UniProt Gene Name
SLC3A1
UniProt Synonym Gene Names
RBAT; NBAT
UniProt Entry Name
SLC31_HUMAN

NCBI Description

This gene encodes a type II membrane glycoprotein which is one of the components of the renal amino acid transporter which transports neutral and basic amino acids in the renal tubule and intestinal tract. Mutations and deletions in this gene are associated with cystinuria. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Involved in the high-affinity, sodium-independent transport of cystine and neutral and dibasic amino acids (system B(0,+)-like activity). May function as an activator of SLC7A9 and be involved in the high-affinity reabsorption of cystine in the kidney tubule. Ref.1 Ref.3 Ref.4 Ref.6

Subunit structure: Disulfide-linked heterodimer with the amino acid transport protein SLC7A9. Ref.11

Subcellular location: Membrane; Single-pass type II membrane protein

Potential.

Tissue specificity: Predominantly expressed in the kidney, small intestine and pancreas. Weakly expressed in liver. Ref.1 Ref.3

Involvement in disease: Cystinuria (CSNU) [MIM:220100]: An autosomal disorder characterized by impaired epithelial cell transport of cystine and dibasic amino acids (lysine, ornithine, and arginine) in the proximal renal tubule and gastrointestinal tract. The impaired renal reabsorption of cystine and its low solubility causes the formation of calculi in the urinary tract, resulting in obstructive uropathy, pyelonephritis, and, rarely, renal failure.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.5 Ref.12 Ref.14 Ref.15 Ref.16 Ref.17 Ref.18 Ref.19 Ref.20Hypotonia-cystinuria syndrome (HCS) [MIM:606407]: Characterized generalized hypotonia at birth, nephrolithiasis, growth hormone deficiency, minor facial dysmorphism, failure to thrive, followed by hyperphagia and rapid weight gain in late childhood.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.12 Ref.13

Research Articles on SLC3A1

Similar Products

Product Notes

The SLC3A1 slc3a1 (Catalog #AAA3222428) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC3A1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC3A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC3A1 slc3a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NIVAANLNES YDINTLRSKS PMQWDNSSNA GFSEASNTWL PTNSDYHTVN. It is sometimes possible for the material contained within the vial of "SLC3A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.