Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human kidney )

Rabbit SLC39A6 Polyclonal Antibody | anti-SLC39A6 antibody

SLC39A6 antibody - middle region

Gene Names
SLC39A6; ZIP6; LIV-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
SLC39A6; Polyclonal Antibody; SLC39A6 antibody - middle region; anti-SLC39A6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMN
Sequence Length
433
Applicable Applications for anti-SLC39A6 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SLC39A6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human kidney )

Immunohistochemistry (IHC) (Human kidney )

Western Blot (WB)

(Host: RabbitTarget Name: HIRIP3Sample Type: 293TAntibody Dilution: 1.0ug/mlSLC39A6 is strongly supported by BioGPS gene expression data to be expressed in HEK293T)

Western Blot (WB) (Host: RabbitTarget Name: HIRIP3Sample Type: 293TAntibody Dilution: 1.0ug/mlSLC39A6 is strongly supported by BioGPS gene expression data to be expressed in HEK293T)

Western Blot (WB)

(Host: RabbitTarget Name: NOP56Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NOP56Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: NOP56Sample Type: MCF7Antibody Dilution: 1.0ug/mlSLC39A6 is strongly supported by BioGPS gene expression data to be expressed in MCF7)

Western Blot (WB) (Host: RabbitTarget Name: NOP56Sample Type: MCF7Antibody Dilution: 1.0ug/mlSLC39A6 is strongly supported by BioGPS gene expression data to be expressed in MCF7)

Western Blot (WB)

(Host: RabbitTarget Name: WT1Sample Type: 721_BAntibody Dilution: 1.0ug/mlSLC39A6 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Western Blot (WB) (Host: RabbitTarget Name: WT1Sample Type: 721_BAntibody Dilution: 1.0ug/mlSLC39A6 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Western Blot (WB)

(WB Suggested Anti-SLC39A6 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-SLC39A6 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-SLC39A6 antibody
This is a rabbit polyclonal antibody against SLC39A6. It was validated on Western Blot and immunohistochemistry

Target Description: Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A6 belongs to a subfamily of proteins that show structural characteristics of zinc transporters.
Product Categories/Family for anti-SLC39A6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
zinc transporter ZIP6 isoform 2
NCBI Official Synonym Full Names
solute carrier family 39 member 6
NCBI Official Symbol
SLC39A6
NCBI Official Synonym Symbols
ZIP6; LIV-1
NCBI Protein Information
zinc transporter ZIP6
UniProt Protein Name
Zinc transporter ZIP6
Protein Family
UniProt Gene Name
SLC39A6
UniProt Synonym Gene Names
LIV1; ZIP6; ZIP-6
UniProt Entry Name
S39A6_HUMAN

NCBI Description

Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A6 belongs to a subfamily of proteins that show structural characteristics of zinc transporters (Taylor and Nicholson, 2003 [PubMed 12659941]).[supplied by OMIM, Mar 2008]

Uniprot Description

SLC39A6: May act as a zinc-influx transporter. Belongs to the ZIP transporter (TC 2.A.5) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter, SLC family; Membrane protein, multi-pass; Membrane protein, integral; Transporter

Chromosomal Location of Human Ortholog: 18q12.2

Cellular Component: cell surface; integral to plasma membrane; endoplasmic reticulum; plasma membrane

Molecular Function: zinc ion transmembrane transporter activity

Biological Process: cellular zinc ion homeostasis; transmembrane transport

Research Articles on SLC39A6

Similar Products

Product Notes

The SLC39A6 slc39a6 (Catalog #AAA3207109) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC39A6 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's SLC39A6 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the SLC39A6 slc39a6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RSCLIHTSEK KAEIPPKTYS LQIAWVGGFI AISIISFLSL LGVILVPLMN. It is sometimes possible for the material contained within the vial of "SLC39A6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.