Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: Slc34a1Sample Type: Rat Thymus lysatesAntibody Dilution: 1.0ug/ml)

Rabbit SLC34A1 Polyclonal Antibody | anti-SLC34A1 antibody

SLC34A1 Antibody - N-terminal region

Gene Names
SLC34A1; NPT2; FRTS2; SLC11; HCINF2; NAPI-3; NPTIIa; NPHLOP1; SLC17A2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC34A1; Polyclonal Antibody; SLC34A1 Antibody - N-terminal region; anti-SLC34A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YVPSPQVLHRIPGTTTYAISSLSPVALTEHSCPYGEVLECHDPLPAKLAQ
Sequence Length
337
Applicable Applications for anti-SLC34A1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of rat SLC34A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: Slc34a1Sample Type: Rat Thymus lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: Slc34a1Sample Type: Rat Thymus lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SLC34A1 antibody
This is a rabbit polyclonal antibody against Slc34a1. It was validated on Western Blot

Target Description: This gene encodes a member of the type II sodium-phosphate cotransporter family. Mutations in this gene are associated with hypophosphatemia nephrolithiasis/osteoporosis 1. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-SLC34A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
sodium-dependent phosphate transport protein 2A isoform 2
NCBI Official Synonym Full Names
solute carrier family 34 member 1
NCBI Official Symbol
SLC34A1
NCBI Official Synonym Symbols
NPT2; FRTS2; SLC11; HCINF2; NAPI-3; NPTIIa; NPHLOP1; SLC17A2
NCBI Protein Information
sodium-dependent phosphate transport protein 2A
UniProt Protein Name
Sodium-dependent phosphate transport protein 2A
UniProt Gene Name
SLC34A1
UniProt Synonym Gene Names
NPT2; SLC17A2; Sodium-phosphate transport protein 2A; Na(+)/Pi cotransporter 2A; NaPi-2a
UniProt Entry Name
NPT2A_HUMAN

NCBI Description

This gene encodes a member of the type II sodium-phosphate cotransporter family. Mutations in this gene are associated with hypophosphatemia nephrolithiasis/osteoporosis 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2009]

Uniprot Description

SLC34A1: May be involved in actively transporting phosphate into cells via Na(+) cotransport in the renal brush border membrane. Probably mediates 70-80% of the apical influx. Defects in SLC34A1 are the cause of hypophosphatemic nephrolithiasis/osteoporosis type 1 (NPHLOP1). Hypophosphatemia results from idiopathic renal phosphate loss. It contributes to the pathogenesis of hypophosphatemic urolithiasis (formation of urinary calculi) as well to that of hypophosphatemic osteoporosis (bone demineralization). Defects in SLC34A1 are the cause of Fanconi renotubular syndrome type 2 (FRTS2). It is a disease resulting from a generalized dysfunction of the proximal kidney tubule leading to decreased solute and water reabsorption. Patients have polydipsia and polyuria with phosphaturia, glycosuria and aminoaciduria. They may develop hypophosphatemic rickets or osteomalacia, acidosis and a tendency toward dehydration. Some eventually develop renal insufficiency. Belongs to the SLC34A transporter family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter; Transporter, SLC family; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 5q35

Cellular Component: apical plasma membrane; brush border; brush border membrane; cell surface; cytoplasm; endosome; integral to plasma membrane; lipid raft; perinuclear region of cytoplasm; plasma membrane; vesicle

Molecular Function: inorganic phosphate transmembrane transporter activity; PDZ domain binding; protein binding; protein complex binding; protein homodimerization activity; sodium-dependent phosphate transmembrane transporter activity; sodium:phosphate symporter activity

Biological Process: cellular phosphate ion homeostasis; cellular protein metabolic process; glycoprotein metabolic process; indole metabolic process; kidney development; ossification; phosphate ion homeostasis; phosphate transport; positive regulation of membrane potential; protein homooligomerization; response to cadmium ion; response to drug; response to estradiol stimulus; response to lead ion; response to magnesium ion; response to mercury ion; response to vitamin A

Disease: Fanconi Renotubular Syndrome 2; Nephrolithiasis/osteoporosis, Hypophosphatemic, 1

Research Articles on SLC34A1

Similar Products

Product Notes

The SLC34A1 slc34a1 (Catalog #AAA3207062) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC34A1 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's SLC34A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC34A1 slc34a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YVPSPQVLHR IPGTTTYAIS SLSPVALTEH SCPYGEVLEC HDPLPAKLAQ. It is sometimes possible for the material contained within the vial of "SLC34A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.