Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SLC2A10 Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysate)

Rabbit anti-Human SLC2A10 Polyclonal Antibody | anti-SLC2A10 antibody

SLC2A10 antibody - middle region

Gene Names
SLC2A10; ATS; ATORS; GLUT10
Reactivity
Human
Applications
Western Blot
Purity
Protein A purified
Synonyms
SLC2A10; Polyclonal Antibody; SLC2A10 antibody - middle region; anti-SLC2A10 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AKKTKPHPRSGDPSAPPRLALSSALPGPPLPARGHALLRWTALLCLMVFV
Sequence Length
541
Applicable Applications for anti-SLC2A10 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SLC2A10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SLC2A10 Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-SLC2A10 Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-SLC2A10 antibody
This is a rabbit polyclonal antibody against SLC2A10. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SLC2A10 is a member of the facilitative glucose transporter family, which plays a significant role in maintaining glucose homeostasis.SLC2A10 is a member of the facilitative glucose transporter family, which plays a significant role in maintaining glucose homeostasis.[supplied by OMIM].
Product Categories/Family for anti-SLC2A10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
solute carrier family 2, facilitated glucose transporter member 10
NCBI Official Synonym Full Names
solute carrier family 2 member 10
NCBI Official Symbol
SLC2A10
NCBI Official Synonym Symbols
ATS; ATORS; GLUT10
NCBI Protein Information
solute carrier family 2, facilitated glucose transporter member 10
UniProt Protein Name
Solute carrier family 2, facilitated glucose transporter member 10
Protein Family
UniProt Gene Name
SLC2A10
UniProt Synonym Gene Names
GLUT10; GLUT-10
UniProt Entry Name
GTR10_HUMAN

NCBI Description

This gene encodes a member of the class III facilitative glucose transporter family. The encoded protein plays a role in regulation of glucose homeostasis. Mutations in this gene have been associated with arterial tortuosity syndrome.[provided by RefSeq, Dec 2009]

Uniprot Description

GLUT10: an integral membrane facilitative glucose transporter. One of 13 members of the human equilibrative glucose transport protein family. Its mRNA is detected in the human heart, lung, brain, liver, skeletal muscle, pancreas, placenta and kidney. The chromosome localization of its gene is in a loci associated with type-2 diabetes.

Protein type: Transporter; Membrane protein, multi-pass; Membrane protein, integral; Transporter, SLC family

Chromosomal Location of Human Ortholog: 20q13.1

Cellular Component: perinuclear region of cytoplasm; cytoplasm; integral to membrane; plasma membrane; endomembrane system

Molecular Function: sugar:hydrogen ion symporter activity

Biological Process: proton transport; glucose transport; transmembrane transport

Disease: Arterial Tortuosity Syndrome

Research Articles on SLC2A10

Similar Products

Product Notes

The SLC2A10 slc2a10 (Catalog #AAA3207181) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC2A10 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC2A10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC2A10 slc2a10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AKKTKPHPRS GDPSAPPRLA LSSALPGPPL PARGHALLRW TALLCLMVFV. It is sometimes possible for the material contained within the vial of "SLC2A10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.