Immunohistochemistry (IHC)
(Human Brain )
Rabbit anti-Human SLC26A8 Polyclonal Antibody | anti-SLC26A8 antibody
SLC26A8 antibody - C-terminal region
Gene Names
SLC26A8; TAT1; SPGF3
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
SLC26A8; Polyclonal Antibody; SLC26A8 antibody - C-terminal region; anti-SLC26A8 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EPQPETEPEMEPNPKSRPRAHTFPQQRYWPMYHPSMASTQSQTQTRTWSV
Sequence Length
552
Applicable Applications for anti-SLC26A8 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SLC26A8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Human Brain )
Immunohistochemistry (IHC)
(Human Brain )
Western Blot (WB)
(WB Suggested Anti-SLC26A8 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)
Western Blot (WB)
(WB Suggested Anti-SLC26A8 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-SLC26A8 antibody
This is a rabbit polyclonal antibody against SLC26A8. It was validated on Western Blot and immunohistochemistry
Target Description: SLC26A8 is one member of a family of sulfate/anion transporters. Family members are well conserved in their protein (aa length among species) structures yet have markedly different tissue expression patterns.
Target Description: SLC26A8 is one member of a family of sulfate/anion transporters. Family members are well conserved in their protein (aa length among species) structures yet have markedly different tissue expression patterns.
Product Categories/Family for anti-SLC26A8 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
61kDa
NCBI Official Synonym Full Names
solute carrier family 26 member 8
NCBI Official Symbol
SLC26A8
NCBI Official Synonym Symbols
TAT1; SPGF3
NCBI Protein Information
testis anion transporter 1
Protein Family
NCBI Description
This gene encodes a member of the SLC26 gene family of anion transporters. Family members are well conserved in gene structure and protein length yet have markedly different tissue expression patterns. The expression of this gene appears to be restricted to spermatocytes. Alternatively spliced transcript variants that encode different isoforms have been described. [provided by RefSeq, Jul 2010]
Research Articles on SLC26A8
Similar Products
Product Notes
The SLC26A8 (Catalog #AAA3207199) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC26A8 antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC26A8 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the SLC26A8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EPQPETEPEM EPNPKSRPRA HTFPQQRYWP MYHPSMASTQ SQTQTRTWSV. It is sometimes possible for the material contained within the vial of "SLC26A8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
