Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using SLC26A11 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

Rabbit anti-Mouse SLC26A11 Polyclonal Antibody | anti-SLC26A11 antibody

SLC26A11 Rabbit pAb

Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
SLC26A11; Polyclonal Antibody; SLC26A11 Rabbit pAb; anti-SLC26A11 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
EILSRALEVSPPRCLVLECTHVCSIDYTVVLGLGELLQDFQKQGVALAFVGLQVPVLRVLLSADLKGFQYFSTLEEAEKHLRQEPGTQPYNIREDSILDQK
Applicable Applications for anti-SLC26A11 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 500-600 of human SLC26A11 (NP_001159819.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using SLC26A11 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using SLC26A11 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)
Related Product Information for anti-SLC26A11 antibody
Background: This gene encodes a member of the solute linked carrier 26 family of anion exchangers. Members of this family of proteins are essential for numerous cellular functions including homeostasis and intracellular electrolyte balance. The encoded protein is a sodium independent sulfate transporter that is sensitive to the anion exchanger inhibitor 4, 4'-diisothiocyanostilbene-2, 2'-disulfonic acid. Alternate splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65,299 Da
NCBI Official Full Name
sodium-independent sulfate anion transporter
NCBI Official Synonym Full Names
solute carrier family 26 (anion exchanger), member 11
NCBI Official Symbol
SLC26A11
NCBI Protein Information
sodium-independent sulfate anion transporter; solute carrier family 26, member 11
UniProt Protein Name
Sodium-independent sulfate anion transporter
UniProt Gene Name
SLC26A11
UniProt Entry Name
S2611_HUMAN

Similar Products

Product Notes

The SLC26A11 slc26a11 (Catalog #AAA9142694) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC26A11 Rabbit pAb reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SLC26A11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the SLC26A11 slc26a11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EILSRALEVS PPRCLVLECT HVCSIDYTVV LGLGELLQDF QKQGVALAFV GLQVPVLRVL LSADLKGFQY FSTLEEAEKH LRQEPGTQPY NIREDSILDQ K. It is sometimes possible for the material contained within the vial of "SLC26A11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.