Rabbit anti-Human SLC25A4 Polyclonal Antibody | anti-SLC25A4 antibody

SLC25A4 Polyclonal Antibody

Cat. Num. AAA9135013

• Gene Names: SLC25A4; T1; ANT; AAC1; ANT1; PEO2; PEO3; ANT 1; PEOA2; MTDPS12; MTDPS12A
• Reactivity: Human
• Applications: Western Blot, Immunofluorescence
• Purity: Affinity Purification
• Synonyms: SLC25A4; Polyclonal Antibody; SLC25A4 Polyclonal Antibody; AAC1; ANT; ANT1; MTDPS12; MTDPS12A; PEO2; PEO3; PEOA2; T1; anti-SLC25A4 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity Purification
• Sequence: HASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEI
• Sequence Length: 298

• Applicable Applications for anti-SLC25A4 antibody: Western Blot (WB), Immunofluorescence (IF)
• Application Notes: WB: 1:500 - 1:2000; IF: 1:50 - 1:200
• Immunogen: Recombinant protein of human SLC25A4
• Immunogen Species: Human
• Storage Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Cellular Location: Mitochondrion inner membrane, Multi-pass membrane protein
• Preparation and Storage: Store at -20 degree C. Avoid freeze / thaw cycles.

Related Product Information for anti-SLC25A4 antibody

This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the cytoplasm into the mitochondrial matrix and ATP from the mitochondrial matrix into the cytoplasm. The protein forms a homodimer embedded in the inner mitochondria membrane. Mutations in this gene have been shown to result in autosomal dominant progressive external opthalmoplegia and familial hypertrophic cardiomyopathy.

Product Categories/Family for anti-SLC25A4 antibody

Polyclonal Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 55749577
• NCBI GeneID: 291
• NCBI Accession #: NP_001142.2
• NCBI GenBank Nucleotide #: NM_001151.3
• UniProt Accession #: P12235; D3DP59
• Molecular Weight: 33kDa
• NCBI Official Full Name: ADP/ATP translocase 1
• NCBI Official Synonym Full Names: solute carrier family 25 member 4
• NCBI Official Symbol: SLC25A4
• NCBI Official Synonym Symbols: T1; ANT; AAC1; ANT1; PEO2; PEO3; ANT 1; PEOA2; MTDPS12; MTDPS12A
• NCBI Protein Information: ADP/ATP translocase 1
• UniProt Protein Name: ADP/ATP translocase 1
• Protein Family: ADP/ATP translocase
• UniProt Gene Name: SLC25A4
• UniProt Synonym Gene Names: ANT1; ANT 1

NCBI Description

This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the cytoplasm into the mitochondrial matrix and ATP from the mitochondrial matrix into the cytoplasm. The protein forms a homodimer embedded in the inner mitochondria membrane. Mutations in this gene have been shown to result in autosomal dominant progressive external opthalmoplegia and familial hypertrophic cardiomyopathy. [provided by RefSeq, Jun 2013]

Uniprot Description

Involved in mitochondrial ADP/ATP transport. Catalyzes the exchange of cytoplasmic ADP with mitochondrial ATP across the mitochondrial inner membrane.