Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit SLC25A29 Polyclonal Antibody | anti-SLC25A29 antibody

SLC25A29 antibody

Gene Names
SLC25A29; CACL; ORNT3; C14orf69
Reactivity
Human, Mouse, Rat, Dog
Applications
Western Blot
Purity
Total IgG Protein A purified
Synonyms
SLC25A29; Polyclonal Antibody; SLC25A29 antibody; Polyclonal SLC25A29; Anti-SLC25A29; FLJ38975; SLCA29 25; SLCA29-25; Solute Carrier Family 25 Member 29; C14orf69; anti-SLC25A29 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat, Dog
Clonality
Polyclonal
Specificity
SLC25A29 antibody was raised against the C terminal of SLC25A29
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC25A29 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
237
Applicable Applications for anti-SLC25A29 antibody
Western Blot (WB)
Application Notes
WB: 1.25 ug/ml
Biological Significance
SLC25A29 belongs to the mitochondrial carrier family and it may has palmitoylcarnitine transporting activity.
Cross-Reactivity
Human,Mouse,Rat,Dog
Immunogen
SLC25A29 antibody was raised using the C terminal of SLC25A29 corresponding to a region with amino acids AEGWRVFTRGLASTLLRAFPVNAATFATVTVVLTYARGEEAGPEGEAVPA
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-SLC25A29 antibody
Rabbit polyclonal SLC25A29 antibody raised against the C terminal of SLC25A29
Product Categories/Family for anti-SLC25A29 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
33 kDa (MW of target protein)
NCBI Official Full Name
SLC25A29 protein
NCBI Official Synonym Full Names
solute carrier family 25 (mitochondrial carnitine/acylcarnitine carrier), member 29
NCBI Official Symbol
SLC25A29
NCBI Official Synonym Symbols
CACL; ORNT3; C14orf69
NCBI Protein Information
mitochondrial basic amino acids transporter
UniProt Protein Name
Mitochondrial basic amino acids transporter
UniProt Gene Name
SLC25A29
UniProt Synonym Gene Names
C14orf69; ORNT3; CACT-like
UniProt Entry Name
MCATL_HUMAN

NCBI Description

This gene encodes a nuclear-encoded mitochondrial protein that is a member of the large family of solute carrier family 25 (SLC25) mitochondrial transporters. The members of this superfamily are involved in numerous metabolic pathways and cell functions. This gene product was previously reported to be a mitochondrial carnitine-acylcarnitine-like (CACL) translocase (PMID:128829710) or an ornithine transporter (designated ORNT3, PMID:19287344), however, a recent study characterized the main role of this protein as a mitochondrial transporter of basic amino acids, with a preference for arginine and lysine (PMID:24652292). Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Apr 2014]

Uniprot Description

SLC25A29: Has palmitoylcarnitine transporting activity. Belongs to the mitochondrial carrier family.

Protein type: Transporter; Membrane protein, integral; Mitochondrial; Transporter, SLC family; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 14q32.2

Cellular Component: mitochondrial inner membrane; integral to membrane

Molecular Function: acyl carnitine transporter activity

Research Articles on SLC25A29

Similar Products

Product Notes

The SLC25A29 slc25a29 (Catalog #AAA5302909) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC25A29 antibody reacts with Human, Mouse, Rat, Dog and may cross-react with other species as described in the data sheet. AAA Biotech's SLC25A29 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1.25 ug/ml. Researchers should empirically determine the suitability of the SLC25A29 slc25a29 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC25A29, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.