Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SLC25A25 Antibody Titration: 0.2-1 ug/mlPositive Control: THP-1 cell lysate)

Rabbit anti-Human SLC25A25 Polyclonal Antibody | anti-SLC25A25 antibody

SLC25A25 antibody - N-terminal region

Gene Names
SLC25A25; MCSC; PCSCL; SCAMC-2
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC25A25; Polyclonal Antibody; SLC25A25 antibody - N-terminal region; anti-SLC25A25 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MLQMLWHFLASFFPRAGCHGSREGDDREVRGTPAPAWRDQMASFLGKQDG
Sequence Length
489
Applicable Applications for anti-SLC25A25 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC25A25
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SLC25A25 Antibody Titration: 0.2-1 ug/mlPositive Control: THP-1 cell lysate)

Western Blot (WB) (WB Suggested Anti-SLC25A25 Antibody Titration: 0.2-1 ug/mlPositive Control: THP-1 cell lysate)
Related Product Information for anti-SLC25A25 antibody
This is a rabbit polyclonal antibody against SLC25A25. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The function remains unknown.
Product Categories/Family for anti-SLC25A25 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
calcium-binding mitochondrial carrier protein SCaMC-2 isoform c
NCBI Official Synonym Full Names
solute carrier family 25 member 25
NCBI Official Symbol
SLC25A25
NCBI Official Synonym Symbols
MCSC; PCSCL; SCAMC-2
NCBI Protein Information
calcium-binding mitochondrial carrier protein SCaMC-2
UniProt Protein Name
Calcium-binding mitochondrial carrier protein SCaMC-2
UniProt Gene Name
SLC25A25
UniProt Synonym Gene Names
APC3; KIAA1896; MCSC3; SCAMC2
UniProt Entry Name
SCMC2_HUMAN

NCBI Description

The protein encoded by this gene belongs to the family of calcium-binding mitochondrial carriers, with a characteristic mitochondrial carrier domain at the C-terminus. These proteins are found in the inner membranes of mitochondria, and function as transport proteins. They shuttle metabolites, nucleotides and cofactors through the mitochondrial membrane and thereby connect and/or regulate cytoplasm and matrix functions. This protein may function as an ATP-Mg/Pi carrier that mediates the transport of Mg-ATP in exchange for phosphate, and likely responsible for the net uptake or efflux of adenine nucleotides into or from the mitochondria. Alternatively spliced transcript variants encoding different isoforms with a common C-terminus but variable N-termini have been described for this gene. [provided by RefSeq, Jul 2012]

Uniprot Description

Function: Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. May act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria. Ref.2

Subcellular location: Mitochondrion inner membrane; Multi-pass membrane protein Ref.1 Ref.2.

Tissue specificity: Present in various cell lines (at protein level). Widely expressed. Expressed in fetal and adult liver, skeletal muscle, testis, ovary, hippocampus and caudate nucleus. Isoform 1 is present in all tissues tested. Isoform 2 expression is restricted to kidney and lung. Ref.1 Ref.2

Sequence similarities: Belongs to the mitochondrial carrier (TC 2.A.29) family. [View classification]Contains 3 EF-hand domains.Contains 3 Solcar repeats.

Sequence caution: The sequence BAB67789.1 differs from that shown. Reason: Erroneous initiation. The sequence CAH73133.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAI13826.1 differs from that shown. Reason: Erroneous gene model prediction.

Research Articles on SLC25A25

Similar Products

Product Notes

The SLC25A25 slc25a25 (Catalog #AAA3207020) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC25A25 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC25A25 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC25A25 slc25a25 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MLQMLWHFLA SFFPRAGCHG SREGDDREVR GTPAPAWRDQ MASFLGKQDG. It is sometimes possible for the material contained within the vial of "SLC25A25, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.