Rabbit SLC25A16 Polyclonal Antibody | anti-SLC25A16 antibody
SLC25A16 antibody
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
SLC25A16; Polyclonal Antibody; SLC25A16 antibody; Polyclonal SLC25A16; Anti-SLC25A16; SLCA16 25; GDC; GDA; hML7; D10S105E; ML7; Mitochondrial Carrier Graves Disease Autoantigen 16; SLCA16-25; Solute Carrier Family 25 Member 16; HGT.1; MGC39851; anti-SLC25A16 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC25A16 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
87
Applicable Applications for anti-SLC25A16 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
SLC25A16 is a protein that contains three tandemly repeated mitochondrial carrier protein domains. The protein is localized in the inner membrane and facilitates the rapid transport and exchange of molecules between the cytosol and the mitochondrial matrix space. SLC25A16 gene has a possible role in Graves' disease.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
SLC25A16 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSHAPTLLGRPSSDNPNVLVLKTHVNLLCGGVAGAIAQTISYPFDVTRRR
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-SLC25A16 antibody
Rabbit polyclonal SLC25A16 antibody
Product Categories/Family for anti-SLC25A16 antibody
NCBI and Uniprot Product Information
NCBI GI #
Molecular Weight
36 kDa (MW of target protein)
NCBI Official Full Name
SLC25A16, partial
Protein Family
Similar Products
Product Notes
The SLC25A16 (Catalog #AAA839229) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC25A16 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC25A16 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the SLC25A16 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC25A16, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
