Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SLC22A17 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: DU145 cell lysate)

Rabbit SLC22A17 Polyclonal Antibody | anti-SLC22A17 antibody

SLC22A17 antibody - middle region

Gene Names
SLC22A17; BOCT; BOIT; 24p3R; NGALR; hBOIT; NGALR2; NGALR3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC22A17; Polyclonal Antibody; SLC22A17 antibody - middle region; anti-SLC22A17 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HCYQPVGGGGSPSDFYLCSLLASGTAALACVFLGVTVDRFGRRGILLLSM
Sequence Length
538
Applicable Applications for anti-SLC22A17 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SLC22A17
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SLC22A17 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: DU145 cell lysate)

Western Blot (WB) (WB Suggested Anti-SLC22A17 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: DU145 cell lysate)
Related Product Information for anti-SLC22A17 antibody
This is a rabbit polyclonal antibody against SLC22A17. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The specific functin of this protein remains unknown.
Product Categories/Family for anti-SLC22A17 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
solute carrier family 22 member 17 isoform a
NCBI Official Synonym Full Names
solute carrier family 22 member 17
NCBI Official Symbol
SLC22A17
NCBI Official Synonym Symbols
BOCT; BOIT; 24p3R; NGALR; hBOIT; NGALR2; NGALR3
NCBI Protein Information
solute carrier family 22 member 17
UniProt Protein Name
Solute carrier family 22 member 17
Protein Family
UniProt Gene Name
SLC22A17
UniProt Synonym Gene Names
BOCT; BOIT; 24p3R; NgalR
UniProt Entry Name
S22AH_HUMAN

Uniprot Description

SLC22A17: Cell surface receptor for LCN2 (24p3) that plays a key role in iron homeostasis and transport. Able to bind iron-bound LCN2 (holo-24p3), followed by internalization of holo-24p3 and release of iron, thereby increasing intracellular iron concentration and leading to inhibition of apoptosis. Also binds iron-free LCN2 (apo-24p3), followed by internalization of apo-24p3 and its association with an intracellular siderophore, leading to iron chelation and iron transfer to the extracellular medium, thereby reducing intracellular iron concentration and resulting in apoptosis. Belongs to the major facilitator (TC 2.A.1) superfamily. Organic cation transporter (TC 2.A.1.19) family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Transporter, SLC family; Membrane protein, integral; Transporter

Chromosomal Location of Human Ortholog: 14q11.2

Cellular Component: integral to plasma membrane; vacuolar membrane

Molecular Function: transmembrane receptor activity; transmembrane transporter activity

Biological Process: cellular iron ion homeostasis; siderophore transport; ion transport; signal transduction; transmembrane transport

Research Articles on SLC22A17

Similar Products

Product Notes

The SLC22A17 slc22a17 (Catalog #AAA3207131) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC22A17 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC22A17 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC22A17 slc22a17 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HCYQPVGGGG SPSDFYLCSL LASGTAALAC VFLGVTVDRF GRRGILLLSM. It is sometimes possible for the material contained within the vial of "SLC22A17, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.